KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577673Help
Entry
577673            CDS       T01019                                 

Definition
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    577673
Enzymes [BR:spu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     577673
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   577673
  Exosomal proteins of colorectal cancer cells
   577673
  Exosomal proteins of bladder cancer cells
   577673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 590 aa AA seqDB search
MNALLLISLLFGVAYGSDVIDFTDDDFKDNIGDHSLILVEFFAPWCGHCKKLAPEFETAA
TTLQRESPPIALAKVDCTANTQTCGAYGVSGYPTLKVFRNGEPSDYQGPRESAGIISFMK
KQAGPKSVVIATEAQFDDFTSGATAAIVGFFADETSAGLKEFKKLTDAFFEEFRFAYTLD
SGLAEKHSGTDKVVLFRPPQLASKFEESQAVFDGAIKKKDVEKFIRENVHGLCGYMTADN
QAQFTKKPLLTAYYNVDYKLDKKGQCFMSLFPIHRVPLTMHHKPTQKHVVPFLENSETPV
LTQKVDLLWLLLKGPRVVVGKTFDEIVNDETKDVLIEFYAPWCGHCKTLEPKYNELGEAA
CMMPGGRSLPKHRWQVQILVMNVGREFIGSVYLSIASASDFQRKLDDYDTSFDAEGGSPV
VAIEGAKGEKFVMPEKFTVKTLKAFIQAFVNGELEPFIKSEDIPASNDGPVKVVVGKTFD
EIVNDETKDVLIEFYAPWCGHCKTLEPKYNELGEALSGDNNIVIAKMDATANDVPPAFEV
RGFPTLYWAPKNNKSSPKKYEGGREVPDFIKFIKKEATSKPVNTGDKTEL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttctgcttatttcgctcctctttggagttgcttacggtagtgatgttata
gattttacagatgatgacttcaaagacaacattggagaccattcactgatattagtggag
ttttttgctccgtggtgcggccattgtaagaaattggctccagagttcgagaccgctgcc
accaccctccagagggagagtcctccaattgccttggctaaggttgactgcacagccaac
acccaaacatgtggtgcctatggtgtatccggctaccctaccctcaaagtattccgcaat
ggagaaccctcagattaccaaggtcccagggaatctgctggtatcatttccttcatgaag
aagcaggctggacccaagtctgtcgtcatcgcgacggaagcacaatttgacgactttacc
tccggtgccactgctgccatcgttggattctttgccgatgaaacaagcgctggattgaag
gaattcaagaaacttaccgatgctttctttgaggaattcagatttgcttacacccttgat
tctggtctggctgaaaaacactcaggcacagataaagtggttctcttcagaccgccacaa
ctcgcgagtaaatttgaagagagtcaagcggtgttcgatggagccatcaaaaagaaggat
gttgagaaattcatcagagaaaatgtccatggactttgtggttacatgacagcagataat
caagcacagttcaccaagaagccactcctgactgcctattacaatgtcgactataaactg
gacaagaaaggtcagtgttttatgtcactctttccaatccacagagtacctttgaccatg
caccacaaacccacacaaaaacatgtagtacccttcctagaaaactcagaaacaccagtt
ttgacgcagaaggtggatctcctgtggttgctattgaaggggccaagggtggttgttggc
aaaacctttgatgagatagtaaacgatgagactaaagacgtcctcattgaattctatgca
ccttggtgtggccattgtaagaccttggagcctaaatacaatgaattgggagaagcggct
tgcatgatgcctggtggtagatcgctgcccaagcatagatggcaggttcaaatcctagta
atgaacgttggtcgggaattcatcggttcggtctacctgtccatcgcctctgctagtgac
ttccaacgaaagctggacgactacgacaccagttttgacgcagaaggtggatctcctgtg
gttgctattgaaggggccaagggcgagaagtttgtcatgccagagaaattcacagttaaa
acacttaaagcattcatccaggcttttgtaaatggtgagctagagccttttatcaagagc
gaagatataccagcgtccaatgatggcccagtcaaggtggttgttggcaaaacctttgat
gagatagtaaacgatgagactaaagacgtcctcattgaattctatgcaccttggtgtggc
cattgtaagaccttggagcctaaatacaatgaattgggagaagcgctcagtggagataat
aacattgtcatagccaagatggacgctaccgccaatgatgtacccccagcatttgaggtc
agagggttcccaaccctttattgggcaccaaagaacaacaaatccagtcccaagaagtac
gagggtggtcgagaggtccccgattttatcaagttcatcaaaaaagaagccacaagtaaa
ccagtcaacaccggagacaagaccgagttgtaa

DBGET integrated database retrieval system