KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577806Help
Entry
577806            CDS       T01019                                 

Gene name
TSP-A
Definition
thrombospondin A
Orthology
K16857  
thrombospondin 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Phagosome
TGF-beta signaling pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    577806 (TSP-A)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    577806 (TSP-A)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    577806 (TSP-A)
Heparan sulfate/heparin binding proteins [BR:spu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  577806 (TSP-A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1293 aa AA seqDB search
MEKIRCFSCFVLFIATLLPAIIAQSSYVEFNVLQDVGISAASPGVDLVRGQEENSVAYKI
KPNKGDMAANTIDVQRLGDAMNDEDGFVLVAKVKMGQKARGTVVSLDGHGHTDRLFGLVI
DRKSDSVLMPYSYRRDGVTTQDSLEFSGLNLEDTEDRDWHTFTLDIQGNLAILYADCTRV
GLQIMYGSFVYDVTPDQYSLRLGKGLKGRKDVPDFKGIIEDVKFIFGQRGTRILRLQGCD
IEASSSQSSSSDISPDFGGQSHDSQLSPFGGGHESIPDVGVGVGVGVGVGVGVGVGPLVS
QPNIHPSVHEVETPEQETIAPVPPKMPEVPTVPNTPHTAIEPGVVEGPLNDGSPMNYNLP
SLYLPNSPGSHNFAEPTNGARPMPNMNDVIPNGQCAITCDQISQLRNMVDVLSQGQENIL
TRVTDMDNRIPSQTPPWLDGCFYKNEIRQNFEEWKDDACTTCECNAPAVTCRLIECQPIT
CQNPIIKPGECCPQCPNEEQGWSDWTEWTSCSVTCGSGTMQRGRSCDRMRYPCNGRSVET
RNCIRDSCVSVVDGGWSNWTPWACGITCGVGTETRVRSCNSPPPQNGGARCLGEAFGAGR
EERLCQRDPCPVDGAWGEWSLWTACTHSCDGGNQERYRFCDSPTPAHGGRNCSGIKRQEQ
MCNQRPCPIDGCLSSPCFEGVDCRSSDDGVFQCGPCPVGFRGDGQSCTDVNECLEVLNTC
FHHHSQHRCINKIPGYSCQECPTGYRGNQPNGIGIFHASRYRQQCIPINPCTEGTHDCAP
DAKCTFFGPYSQPQYGCRCRTGYAGDGYACGLDSDLDGRPDVDLDCQGLGDYMHCHKDNC
PRLPNSGQEDSDRDGEGDACDDDDDDDGIRDDRDNCQFTPNRWQGDRDRDKVGDECDNCP
THSNPRQENVDGDEFGDECDDDIDNDGHDNFIDNCPKHANANQDDSDHDGLGDLCDNCPF
DFNPLQIDTDDDNVGDECDTDEDVDGDGHQDNLDNCPDIPNASQKDHDNDGIGDACDPDD
DNDGVTDADDNCRLVFNPSQNDTDENGRGDACESDFDGDGVADIMDACPENSMIQRTDLS
AFQMVPMDPSGASQLEPNWMVRNHGLELVQTINSDPGLAVGYDEFESVEFSGTFYVNTAK
DDDYAGFIFGYQSNHRFYAVMWKQVTQKYWQPDPSPAEATAGLQLKLINSTTGPGEYLRN
AMWHTGDTENQVKLIWSDPNKIGWKDFTAYRWTVQHRPIDGFMQVTAWEGSNVLADSGPL
YDSTLRGGRLGLYCFSQEMVFFSDMEYRCLSDY
NT seq 3882 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatacggtgtttttcgtgcttcgtactcttcatagcgactctattacctgca
ataattgcacaatcgtcgtacgttgaattcaatgtccttcaagacgtgggtatctctgct
gcatcacccggggtagatcttgtaagaggacaagaagagaactcggtagcttataagatc
aaacctaacaaaggtgacatggcagctaatactatcgacgtgcaacgtctcggagatgct
atgaacgatgaagatggcttcgtactcgtcgccaaagtgaagatgggtcagaaagctcgg
ggaaccgtagtgtccctagatggtcatggccacacagatagactctttggcttggtgatt
gaccgtaagagtgatagtgtcttgatgccatactcgtacagaagggatggtgttactacg
caagattcattggagttctcaggtctgaatcttgaagatacagaggatagagactggcat
accttcacgttagatatccaaggtaacttggcaatcctgtatgctgactgtaccagggtt
ggtcttcagatcatgtatggaagctttgtctatgatgtcacacctgatcaatattccctc
aggcttggaaaaggactcaaggggcgaaaagacgtgccagattttaagggtatcatagaa
gatgtgaagtttatctttggtcagcgaggtactcgtattctccgtctacaaggatgtgat
atcgaggccagctccagccaatcgtcaagctcagatatatcaccagatttcggtggacaa
agtcatgacagtcaactctcaccgttcggtgggggacacgaaagcataccagatgttgga
gtcggagtcggagtaggagtcggtgtgggagtaggagtaggagttggtcctttggtcagt
caaccaaatatccacccatcagtccatgaggtcgaaacccctgaacaagaaacaatcgca
cccgtaccccctaagatgcccgaagtcccaaccgttcccaatactccccataccgcgatc
gagcccggagtcgtcgagggaccgctcaatgacggatctccgatgaattacaatctcccg
tcgctataccttccgaacagtcccggatcgcacaatttcgcagagccgacaaacggtgcg
agaccaatgccgaacatgaatgatgtcataccaaacggtcaatgcgctatcacatgtgat
caaatctcgcagttacgaaatatggtcgacgtgctttcacagggacaagaaaatatcctc
accagggtgactgacatggataacagaataccaagtcaaactcctccctggttagatgga
tgtttctataagaatgagatcagacaaaacttcgaggaatggaaggacgatgcctgtact
acctgcgaatgcaatgcccctgctgtgacgtgtcgtttgattgaatgtcaaccaatcaca
tgccagaatcctatcatcaaaccaggagaatgctgccctcaatgtccaaatgaggagcag
ggatggagtgattggaccgaatggacatcttgttcagttacttgtggttctggtaccatg
cagagaggacgctcgtgtgataggatgaggtatccctgtaacggacgaagtgtggagacc
aggaactgcatccgggactcgtgtgtctcggttgttgatggtggttggagtaactggaca
ccatgggcttgtggtatcacatgtggtgtaggaactgagactagagtacgatcctgtaac
tctccacccccgcagaacggcggggcaaggtgtctgggtgaagcctttggagcaggacgt
gaagagagactgtgtcagcgagacccgtgccctgttgatggagcttggggggagtggtcg
ctgtggacggcatgtacccattcttgtgatggtggtaatcaggagaggtatcgattctgt
gatagccccacccctgcacatggtggtaggaattgttcaggtatcaaaaggcaagaacag
atgtgcaaccagagaccatgtccgattgatgggtgtctttccagcccatgctttgaaggt
gttgattgccgtagtagtgatgatggtgtgttccagtgtggcccatgtccggttggtttc
agaggggatggccaatcatgtacagatgtcaatgagtgtcttgaggttctaaatacgtgt
ttccatcatcacagtcaacataggtgtatcaataagatccctggatactcctgccaagaa
tgcccaactggttaccgtggtaaccaacctaatggtatcggtatcttccatgctagcaga
tacagacagcaatgtatcccgatcaacccatgtacagaaggcactcatgactgtgctcct
gatgctaagtgtacattcttcggaccttatagtcaacctcaatacggatgtcggtgccga
acaggatacgctggagatggatacgcatgtggactagacagtgatctcgatggccgacct
gatgtcgatctcgactgccaaggactcggtgattacatgcattgtcataaggataattgt
cctcgtctgccaaacagtggacaagaagacagcgatcgcgatggggagggagatgcttgc
gatgacgacgacgatgatgatggtatcagagacgacagggataactgtcagtttactccc
aaccgatggcaaggagatcgagatcgtgacaaggttggtgatgagtgtgataactgccct
actcactccaatccaaggcaagagaatgtcgatggcgatgagttcggtgacgaatgcgat
gacgacatcgataatgacggacacgacaactttatagataactgcccgaaacacgccaac
gctaaccaggatgacagtgatcatgatggtctgggtgatctctgtgataactgtccattc
gacttcaaccctctacagatcgataccgatgatgataacgttggcgatgaatgtgacacg
gatgaagacgtggatggtgacggtcatcaagataatctagataactgtcccgacatccct
aatgctagtcagaaggatcatgataatgatggcatcggtgatgcgtgtgatccggatgac
gataacgatggcgtgaccgatgccgatgataactgtcgtctggtttttaatcctagtcag
aacgataccgatgagaatggacgcggtgatgcgtgtgaatctgactttgatggtgatggt
gtagctgatatcatggatgcttgtcctgagaatagtatgatccaaagaacagatctctca
gcattccagatggtacctatggatccatcaggagcatctcaactcgagcctaactggatg
gttaggaatcatggtctggagctggtgcagactatcaacagtgatccaggattagctgtc
ggctatgacgagtttgagagcgtagagtttagtggtacattctatgtgaacacagcgaaa
gatgatgattatgctgggttcatctttggctaccaatccaatcatcgattctatgctgtc
atgtggaagcaggtcacgcagaaatactggcaacctgaccctagccctgctgaagctact
gctggtcttcaactcaagctgattaactcaacaactggcccaggagaatacctgagaaac
gctatgtggcacactggagatacagaaaaccaggtgaagttgatttggagcgatccaaac
aagattgggtggaaagatttcacagcttacagatggacagtccaacacagacccattgat
ggatttatgcaggtgacagcgtgggaaggtagtaatgtattggcagactctggccccctc
tacgactcaacgttacgcggaggacgattgggactatattgcttctctcaggagatggtc
ttcttctccgacatggaatatagatgcctatcagattactaa

DBGET integrated database retrieval system