KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577839Help
Entry
577839            CDS       T01019                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:spu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:spu03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 180 aa AA seqDB search
RKSMRYYPTRLAINLASGVSSMAKDDHKDGFIVVETNFRIYAYTESDLQVEILGLFCSMM
YRFPNLSVAALTRESVQLAISNGITAEQILSFLRTHAHPNMRLKTPIVPPTISDQVRLWE
LERDRLSFTQGIIYNEFLSLHDFEVLRDYAKDLGVLIWDSTARRIMIVSPAGHDSVKKYW
NT seq 542 nt NT seq  +upstreamnt  +downstreamnt
aggaagtccatgcgctactatccaaccaggctagccatcaacttagcttcaggtgtatca
agtatggccaaggacgatcacaaagacggcttcatcgtcgtggaaaccaacttccgtatt
tatgcctacacagagtcggatctgcaggttgaaatactgggactcttttgctctatgatg
tacaggtttccaaacctttctgtggctgctctgacaagggaaagtgtacagttagccata
tcgaatggaatcacagctgaacagattctaagttttttgagaactcatgcacaccctaac
atgagactgaagacacctatcgtacctcctactatcagtgatcaggtcagactctgggag
ctggagagagacagactcagttttacacagggtatcatatacaatgagttcttgtctctt
catgactttgaggtgctacgggactatgctaaggatcttggtgtacttatctgggatagt
actgcacgacgcatcatgatcgtttctccggcagggcatgatagtgtcaagaagtactgg
aa

DBGET integrated database retrieval system