KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577839Help
Entry
577839            CDS       T01019                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    577839
  Replication and repair
   03420 Nucleotide excision repair
    577839
Transcription machinery [BR:spu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     577839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 180 aa AA seqDB search
RKSMRYYPTRLAINLASGVSSMAKDDHKDGFIVVETNFRIYAYTESDLQVEILGLFCSMM
YRFPNLSVAALTRESVQLAISNGITAEQILSFLRTHAHPNMRLKTPIVPPTISDQVRLWE
LERDRLSFTQGIIYNEFLSLHDFEVLRDYAKDLGVLIWDSTARRIMIVSPAGHDSVKKYW
NT seq 542 nt NT seq  +upstreamnt  +downstreamnt
aggaagtccatgcgctactatccaaccaggctagccatcaacttagcttcaggtgtatca
agtatggccaaggacgatcacaaagacggcttcatcgtcgtggaaaccaacttccgtatt
tatgcctacacagagtcggatctgcaggttgaaatactgggactcttttgctctatgatg
tacaggtttccaaacctttctgtggctgctctgacaagggaaagtgtacagttagccata
tcgaatggaatcacagctgaacagattctaagttttttgagaactcatgcacaccctaac
atgagactgaagacacctatcgtacctcctactatcagtgatcaggtcagactctgggag
ctggagagagacagactcagttttacacagggtatcatatacaatgagttcttgtctctt
catgactttgaggtgctacgggactatgctaaggatcttggtgtacttatctgggatagt
actgcacgacgcatcatgatcgtttctccggcagggcatgatagtgtcaagaagtactgg
aa

DBGET integrated database retrieval system