KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577889Help
Entry
577889            CDS       T01019                                 

Definition
agmatinase, mitochondrial-like
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    577889
Enzymes [BR:spu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     577889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 360 aa AA seqDB search
MFGVFILRESLKRLSFVRQAHPAVRRTTRRSFASSSSSRRQLNEPLSGAKFPRVGGISTM
MRLPHQTDTIGLDACYVGVPLDIGTSYRSGTRLGPRQIRYESFVLGPCNYTGAAPFESLQ
VADIGDVTLNLYDLKKSVEMIREQYATIVANGCKPLTLGGDHTLTYPILQAIKEKYGPVG
LVHIDAHDDVADTMLGEKVTHGTPFRRAAEEGCLDPKRVIQIGLRGSNYSPPNDLYEYQK
EMGFQVVPAHRCWHKSMEPLMEKVRNMMGDGPVYLSFDIDSIDPGLAPGTGTPEIAGLTT
IQALEIVRGCKGLNLVGADLVEVSPPYDPMGTTALIGANLLFEMLCVLPGVKYYEMEDFI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgttcggagttttcatcctgagggaatcgttgaagaggttgtcgtttgtccgccaagct
cacccggcagttcggcggacaactcggagaagtttcgctagcagtagcagtagcagacga
cagctgaatgagcccctcagtggagcaaagttcccgcgagttggaggaattagcacaatg
atgagactacctcatcaaacagatactataggtctagatgcctgttatgttggagtgcct
ctggatattgggacgtcctaccggtctggtaccagacttggtcctcggcagatccgctat
gagtcattcgttcttggaccatgcaattatacaggtgctgccccatttgagtcacttcag
gttgctgacatcggggatgtgacccttaacctctacgacctgaagaaatctgtcgagatg
attcgagagcagtatgccaccatcgttgctaatggatgcaagcccctgactctaggaggg
gaccacactcttacataccccatccttcaagcaattaaggagaagtatggtccggtcggt
ctcgttcacatcgatgcccatgatgatgtcgccgacactatgttaggggagaaggtcact
cacggtacccctttccgtcgggcagcggaagaggggtgtctggatccgaagagggtcatt
cagattggattgagggggtcaaattacagccccccaaacgacctctacgaataccaaaaa
gagatgggtttccaggttgtacccgcccatcggtgttggcataaatctatggaaccattg
atggagaaagtcagaaacatgatgggagatggtccggtctatctgtccttcgacattgat
tccatagaccctggactagcaccaggaacaggtactccagaaatagctggtctgacaacg
attcaggcattggagattgtgagaggatgcaaaggcctgaatttagtcggagctgatctg
gtagaggtgtcaccaccctatgatccaatgggaacgactgccctcatcggagctaatctt
ctctttgaaatgctgtgtgtactccccggtgtgaaatactatgaaatggaggatttcata
tga

DBGET integrated database retrieval system