KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577996Help
Entry
577996            CDS       T01019                                 

Definition
histone deacetylase 11-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 491 aa AA seqDB search
MAEPDDSLLAQTTDTEPALVVGGIKENRETRCEDTSMEEEAVSDDPTNGEEVRLSEINDE
PEQSLVSMQEDRHVERRTSESDDIEEEEREEESTEQEIAEQYAKIRERIQKSKLYVNVEP
HQWPIIYSPDYNISFLGFEKLHPFDSGKWGKVYNLLKKEGMFCDETTVCPLEATEDDLLV
AHTKQYISRLKWSISVAGITEIPPVALLPNYIVQKKVLRPLRLQTGGSILAAKLAMERGW
AINIGGGFHHCSSKQGGGFCAYADITLALRFLFHQGTIKKAMILDLDAHQGNGHERDFMQ
DKESVYILDVYNRHIYPRDGFAKRGISRKVEVNYFIADEQYMTLVASNLEAALNEFVPDI
LVYNAGTDSLEGDPLGALSITPQGIIKRDMMVFEFARDRPKPIPIVMVTSGGYQRNNADI
IAASILNLWRRGLIACPEAEEYQGKQEPSSSTSRQPEEGETAGETPSTSNADATTQGNRG
FFRSFLGFLGR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccagatgatagtttgttagcacagaccacagatacggaaccagcattagtc
gtaggtggaattaaagagaatagagaaacccgatgtgaagacaccagcatggaggaggag
gctgtgagtgatgatccaactaatggtgaggaggtccggctttcagagataaatgacgaa
ccggaacaaagcctagtttctatgcaggaagatagacacgttgaaagaagaacttctgaa
agtgatgacatagaagaggaagaaagagaggaggaaagcacggaacaagagattgcagaa
caatatgctaaaataagggaaagaattcaaaaatcaaaactgtatgtgaatgtggagcct
catcagtggcctataatctactcacccgattacaatattagcttccttggattcgagaaa
ctccatccatttgactcaggaaaatgggggaaggtgtacaatctactcaaaaaagaaggg
atgttttgtgacgagacaacagtctgccctttagaagccacagaagatgatctcttagta
gcacatacaaagcaatacatctctcgtttaaagtggagtatttctgtagcgggtataaca
gaaatacctcctgtcgctcttcttccaaactacattgttcagaagaaagtgttaagacca
ctcagattacaaactggtggatctatcttggctgccaaactagccatggagaggggttgg
gcaatcaacattggaggtggattccaccactgttccagtaagcagggcggaggcttctgt
gcttacgctgacatcaccttggctctacgcttcctctttcatcaaggtaccataaagaag
gccatgatcttagatctggatgcacatcaaggcaacggccacgagagggacttcatgcaa
gataaagagtctgtctatatactggatgtctacaacaggcatatatacccaagggatgga
ttcgcaaagaggggcatcagccgaaaggtagaagtgaactacttcattgcagatgagcaa
tatatgacattggttgcaagtaacctggaagcagcattgaatgagtttgttcctgacata
ctggtctacaatgccggcacagattcccttgaaggagacccgcttggagctctctccatc
actccacagggaataatcaaacgcgatatgatggtgtttgaatttgctcgtgacagacct
aagcctattccaatcgtcatggtgacgtctggaggataccaaagaaacaatgcagatatc
atagcagcttcaatcctcaacctatggaggagagggcttatagcatgtccagaggcagaa
gaatatcaaggtaagcaagagccatcctcatcaactagtagacaaccagaagaaggagaa
acagcaggagaaacaccttccacatcaaatgctgacgctaccacacagggcaatagagga
ttcttcagatccttcctaggattcttgggaagatga

DBGET integrated database retrieval system