KEGG   Strongylocentrotus purpuratus (purple sea urchin): 577996Help
Entry
577996            CDS       T01019                                 

Definition
(RefSeq) histone deacetylase 11
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     577996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MAEPDDSLLAQTTDTEPALVVGGIKENRETRCEDTSMEEEAVSDDPTNGEEVRLSEINDE
PEQSLVSMQEDRHVERRTSESDDIEEEEREEESTEQEIAEQYAKIRERIQKSKLYVNVEP
HQWPIIYSPDYNISFLGFEKLHPFDSGKWGKVYNLLKKEGMFCDETTVCPLEATEDDLLV
AHTKQYISRLKKDISEGFPKWSISVAGITEIPPVALLPNYIVQKKVLRPLRLQTGGSILA
AKLAMERGWAINIGGGFHHCSCKQGGGFCAYADITLALRFLFHQGTIKKAMILDLDAHQG
NGHERDFMQDKESVYILDVYNRHIYPRDGFAKRGISRKVEVNYFIADEQYMTLVASNLEA
ALNEFVPDILVYNAGTDSLEGDPLGALSITPQGIIKRDMMVFEFARDRPKPIPIVMVTSG
GYQRNNADIIAASILNLWRRGLIACPEAEEYQGKQEPSSSTSRQPEEGETAGETPSTSNA
DATTQGNRGFFRSFLGFLGR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccagatgatagtttgttagcacagaccacagatacggaaccagcattagtc
gtaggtggaattaaagagaatagagaaacccgatgtgaagacaccagcatggaggaggag
gctgtgagtgatgatccaactaatggtgaggaggtccggctttcagagataaatgacgaa
ccggaacaaagcctagtttctatgcaggaagatagacacgttgaaagaagaacttctgaa
agtgatgacatagaagaggaagaaagagaggaggaaagcacggaacaagagattgcagaa
caatatgctaaaataagggaaagaattcaaaaatcaaaactgtatgtgaatgtggagcct
catcagtggcctataatctactcacccgattacaatattagcttccttggattcgagaaa
ctccatccatttgactcaggaaaatgggggaaggtgtacaatctactcaaaaaagaaggg
atgttttgtgacgagacaacagtctgccctttagaagccacagaagatgatctcttagta
gcacatacaaagcaatacatctctcgtttaaagaaggatatatcagagggctttcctaag
tggagtatttctgtagcgggtataacagaaatacctcctgtcgctcttcttccaaactac
attgttcagaagaaagtgttaagaccactcagattacaaactggtggatctatcttggct
gccaaactagccatggagagaggctgggcaatcaacattggaggtggattccaccactgt
tcctgcaagcaaggcggaggcttctgtgcttacgctgacatcaccttggctctacgcttc
ctctttcatcaaggtaccataaagaaggccatgatcttagatctggatgcacatcaaggc
aacggccacgagagggacttcatgcaagataaagagtctgtctatatactggatgtctac
aacaggcatatatacccaagggatggattcgcaaagaggggcatcagccgaaaggtagaa
gtgaactacttcattgcagatgagcaatatatgacattggttgcaagtaacctggaagca
gcattgaatgagtttgttcctgacatactggtctacaatgccggcacagattcccttgaa
ggagacccgcttggagctctctccatcactccacagggaataatcaaacgcgatatgatg
gtgtttgaatttgctcgtgacagacctaagcctattccaatcgtcatggtgacgtctgga
ggataccaaagaaacaatgcagatatcatagcagcttcaatcctcaacctatggaggaga
gggcttatagcatgtccagaggcagaagaatatcaaggtaagcaagagccatcctcatca
actagtagacaaccagaagaaggagaaacagcaggagaaacaccttccacatcaaatgct
gacgctaccacacagggcaatagaggattcttcagatccttcctaggattcttgggaaga
tga

DBGET integrated database retrieval system