KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578030Help
Entry
578030            CDS       T01019                                 

Definition
(RefSeq) transforming acidic coiled-coil-containing protein 3
  KO
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    578030
Messenger RNA biogenesis [BR:spu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     578030
   mRNA cycle factors
    P-body specific factors
     578030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 822 aa AA seqDB search
MNGCPFSPAFEDKENPVTPKAFRSPSSLPHSILKPLNIINIVTPLPVCKSLKIYNSLEFC
PCNMGGCLSNDFPSDETRSPEGVSFKTPAQLSQAPHSNSPYGAVRDLDEQERWSERATVV
TKPDHEDYMIIASEILNNIILNLPVGEVATAPDSVTPVVPAPEAEANLQVQDSAPSSPPN
QSPPREGNADAPPSEGGATMEDSVSTPPPPSPEPARQNIYELNDEDIANMNPFQSTTKMQ
NSPPITKKPMADNQYSADIDFDNIKDPFGTCSKVANTPETINRSPKQKKRSPKTKSPTPE
PEKDLVPPANNDNDVAVDVDVEKEVNEEEHSPPSPEDVMLQSPQMNGGDDLGNDLDKEED
NNVQLLSTGDGDSGVASAEERQPDEVMPSFDAQDEIPDMIGDDEFRPAMEASEEGGGVGG
GGGGHGGLTRDISFEEMEFRLAEEVFANSDPTHFDVDYLAQAGGSDEFKESALARQSLYV
KFDPLVKGCPTPQGPSALPALEPEGGDLLQMQTPPPGQVLDGRAKRRAAANERSNTSPEN
TAASKNVENLLQYTPKSDFDSEDPMDSANSSTEIPSSVPQTVTSSDEGIVQILRYSQADM
DAAVLEAARSASIEAQRVAEEKYKEYEKKFHSSNENIKEVTKSKEVLEKSSSDMRALIME
YEKSIQQLMVDVSQAKTSSDDKASQLQKEKDQALEDMASVESAFSDLHRRYEKLKQTLDG
YRKNEETLKKHVTEYQGKVKKQEQRYQTLKSHAEEKIEKANEQITKVTKSYQSEIAGLTA
NLKREQMNVEGLEKTIQQKTKQCGELTNICDELISKMGSSGQ
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggtgcccgttttctccagcgtttgaagataaggaaaatccagtcactcctaag
gcgtttaggagcccttccagcttaccccactcgatcctgaaaccattgaacatcatcaat
attgttacccctctgcctgtctgcaagagtttgaagatttacaactcgttagagttctgc
ccgtgtaacatgggtggttgcttatccaacgattttccgtctgacgaaactcgttctcca
gaaggggtatccttcaagactccagcacaactaagccaggcccctcacagcaactccccg
tacggtgccgtccgagatttggacgagcaagaacgctggtccgagagggccaccgtagtt
accaagccggaccatgaggattacatgatcattgcttctgagatcctcaacaatatcatc
cttaatcttcccgtcggcgaagtcgccactgctcctgattccgttacccccgttgttcca
gctcctgaggccgaggccaacctgcaggtccaagactctgcacccagcagccccccaaac
cagtcacctcctagggagggtaacgcagacgcgcccccttcagagggcggggccaccatg
gaggacagtgtcagcacccctcctcctccatctccggagccagctcgtcaaaacatctac
gagctcaacgatgaggacatcgctaatatgaacccgttccagagtaccaccaagatgcag
aactctccacctattaccaagaaacccatggcagacaaccagtactctgcagacattgac
tttgataacatcaaggatccctttggtacctgcagcaaagtggccaatacacccgagacc
atcaaccggtctccaaagcagaagaagaggtctcccaagaccaaatccccgaccccagaa
cccgaaaaggaccttgtgcctcctgccaacaatgataacgacgttgctgtcgatgttgat
gtcgagaaagaggtgaatgaagaggagcacagccccccatccccggaggacgtcatgctc
cagtcccctcagatgaacggtggggatgatctcgggaacgatctcgacaaagaggaggat
aacaatgtgcagctgctgtcgacgggagatggtgacagcggggtcgcgagtgcagaggaa
agacagcctgatgaggtcatgccttcatttgatgctcaagatgaaattccagatatgatt
ggtgatgacgaattcagaccagctatggaagcctctgaagaaggaggaggagtaggagga
ggagggggcggtcatgggggactcactcgagacataagctttgaagagatggagttcagg
ttggcagaagaagtgtttgccaatagtgatcctacgcactttgatgtggactatctggca
caagcaggaggctcagatgaattcaaggagtcggcgttggccaggcagtctctttatgtc
aagtttgatcctcttgtcaaaggatgcccaacaccacaaggcccatcggctctgcctgcc
ttagagccagagggcggagacctgcttcagatgcagacccctcccccaggccaggtcctt
gacggtagggccaagaggagagcagccgccaacgagaggtccaacaccagtccagagaac
acggcggccagtaagaacgtggaaaacctactgcagtacactcctaagagtgatttcgat
tcagaggatccaatggatagtgccaactcaagcactgaaattccttcctcagtacctcag
acagtcaccagcagtgatgaaggcatagtacagatcctgcgttactcacaggcagatatg
gatgctgcagtgttagaggctgctaggtcagcaagcatcgaagcacagagagttgctgaa
gagaaatacaaggaatatgaaaagaagttccattcaagcaacgagaatatcaaagaagtc
accaagtccaaggaggtgttagagaaatccagttcagatatgagagcactgatcatggaa
tatgagaaatccatacagcaactaatggtggacgtgtcgcaggccaagacttcatcagac
gacaaggcgtcgcagctgcagaaagaaaaggaccaagcccttgaggacatggcctcagtc
gagagtgccttcagcgacctgcacaggagatacgagaagttaaaacagacacttgatggc
tacagaaagaatgaggagacattgaagaagcatgtaactgaataccagggcaaggtgaag
aaacaagagcagagataccagacacttaaatcacatgcagaggagaaaatagaaaaagcc
aatgaacaaatcaccaaggtaaccaagagttaccagtcagagattgctggtctcacggca
aacttgaagagagaacagatgaacgtagaaggtctggagaaaaccattcaacaaaagacc
aaacaatgtggagagttgacaaatatttgtgatgaacttatttccaaaatgggaagcagc
ggtcaatga

DBGET integrated database retrieval system