KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578030Help
Entry
578030            CDS       T01019                                 

Definition
uncharacterized LOC578030
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:spu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 758 aa AA seqDB search
MNGCPFSPAFEDKENPVTPKAFRSPSSLPHSILKPLNIINIVTPLPVCKSLKVSFKTPAQ
LSQAPHSNSPYGAVRDLDEQERWSERATVVTKPDHEDYMIIASEILNNIILNLPVGEVAT
APDSVTPVVPAPEAEANLQVQDSAPSSPPNQSPPREGNADAPPSEGGATMEDSVSTPPPP
SPEPARQNIYELNDEDIANMNPFQSTTKMQNSPPITKKPMADNQYSADIDFDNIKDPFGT
CSKVANTPETINRSPKQKKRSPKTKSPTPEPEKDLVPPANNDNDVAVDVDVEKEVNEEEH
SPPSPEDVMLQSPQMNGGDDLGNDLDKEEDNNVQLLSTGDGDSGVASAEERQPDEVMPSF
DAQDEIPDMIGDDEFRPAMEVFANSDPTHFDVDYLAQAGGSDEFKESALARQSLYVKFDP
LVKGCPTPQGPSALPALEPEGGDLLQMQTPPPGQVLDGRAKRRAAANERSNTSPENTAAS
KNVENLLQYTPKSDFDSEDPMDSANSSTEIPSSVPQTVTSSDEGIVQILRYSQADMDAAV
LEAARSASIEAQRVAEEKYKEYEKKFHSSNENIKEVTKSKEVLEKSSSDMRALIMEYEKS
IQQLMVDVSQAKTSSDDKASQLQKEKDQALEDMASVESAFSDLHRRYEKLKQTLDGYRKN
EETLKKHVTEYQGKVKKQEQRYQTLKSHAEEKIEKANEQITKVTKSYQSEIAGLTANLKR
EQMNVEGLEKTIQQKTKQCGELTNICDELISKMGSSGQ
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggtgcccgttttctccagcgtttgaagataaggaaaatccagtcactcctaag
gcgtttaggagcccttccagcttaccccactcgatcctgaaaccattgaacatcatcaat
attgttacccctctgcctgtctgcaagagtttgaaggtatccttcaagactccagcacaa
ctaagccaggcccctcacagcaactccccgtacggtgccgtccgagatttggacgagcaa
gaacgctggtccgagagggccaccgtagttaccaagccggaccatgaggattacatgatc
attgcttctgagatcctcaacaatatcatccttaatcttcccgtcggcgaagtcgccact
gctcctgattccgttacccccgttgttccagctcctgaggccgaggccaacctgcaggtc
caagactctgcacccagcagccccccaaaccagtcacctcctagggagggtaacgcagac
gcgcccccttcagagggcggggccaccatggaggacagtgtcagcacccctcctcctcca
tctccggagccagctcgtcaaaacatctacgagctcaacgatgaggacatcgctaatatg
aacccgttccagagtaccaccaagatgcagaactctccacctattaccaagaaacccatg
gcagacaaccagtactctgcagacattgactttgataacatcaaggatccctttggtacc
tgcagcaaagtggccaatacacccgagaccatcaaccggtctccaaagcagaagaagagg
tctcccaagaccaaatccccgaccccagaacccgaaaaggaccttgtgcctcctgccaac
aatgataacgacgttgctgtcgatgttgatgtcgagaaagaggtgaatgaagaggagcac
agccccccatccccggaggacgtcatgctccagtcccctcagatgaacggtggggatgat
ctcgggaacgatctcgacaaagaggaggataacaatgtgcagctgctgtcgacgggagat
ggtgacagcggggtcgcgagtgcagaggaaagacagcctgatgaggtcatgccttcattt
gatgctcaagatgaaattccagatatgattggtgatgacgaattcagaccagctatggaa
gtgtttgccaatagtgatcctacgcactttgatgtggactatctggcacaagcaggaggc
tcagatgaattcaaggagtcggcgttggccaggcagtctctttatgtcaagtttgatcct
cttgtcaaaggatgcccaacaccacaaggcccatcggctctgcctgccttagagccagag
ggcggagacctgcttcagatgcagacccctcccccaggccaggtccttgacggtagggcc
aagaggagagcagccgccaacgagaggtccaacaccagtccagagaacacggcggccagt
aagaacgtggaaaacctactgcagtacactcctaagagtgatttcgattcagaggatcca
atggatagtgccaactcaagcactgaaattccttcctcagtacctcagacagtcaccagc
agtgatgaaggcatagtacagatcctgcgttactcacaggcagatatggatgctgcagtg
ttagaggctgctaggtcagcaagcatcgaagcacagagagttgctgaagagaaatacaag
gaatatgaaaagaagttccattcaagcaacgagaatatcaaagaagtcaccaagtccaag
gaggtgttagagaaatccagttcagatatgagagcactgatcatggaatatgagaaatcc
atacagcaactaatggtggacgtgtcgcaggccaagacttcatcagacgacaaggcgtcg
cagctgcagaaagaaaaggaccaagcccttgaggacatggcctcagtcgagagtgccttc
agcgacctgcacaggagatacgagaagttaaaacagacacttgatggctacagaaagaat
gaggagacattgaagaagcatgtaactgaataccagggcaaggtgaagaaacaagagcag
agataccagacacttaaatcacatgcagaggagaaaatagaaaaagccaatgaacaaatc
accaaggtaaccaagagttaccagtcagagattgctggtctcacggcaaacttgaagaga
gaacagatgaacgtagaaggtctggagaaaaccattcaacaaaagaccaaacaatgtgga
gagttgacaaatatttgtgatgaacttatttccaaaatgggaagcagcggtcaatga

DBGET integrated database retrieval system