KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578064Help
Entry
578064            CDS       T01019                                 

Definition
glucose-6-phosphatase-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    578064
   00052 Galactose metabolism
    578064
   00500 Starch and sucrose metabolism
    578064
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    578064
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     578064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 272 aa AA seqDB search
MIGQRPYWWVMESNVYTGEERPFLKQFKITCETGPGCPSGHAMVAASVWFVFVASLNEYI
MSEVRSVQRAKKATRITWTIYSLFIVLVCVSRVYTATHFPHQVILGALTGIIVAAETRKL
SVENYGFGSYFLGGLFVLVSIFLEYYLISLVGLDPGWSMKLALKRCVYREWVHMDTTLFY
AISRDVGAFFFAGMMCSCLTVKYDRVRGQFAKKLTATLLTVAAAHVIESMYVPRGYVILF
YILGALKYGLVSISTVGLNQAVSSYGSQNQNL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgataggacagcgtccctattggtgggtcatggagagtaatgtttacactggtgaagaa
cgtccattcctgaaacagttcaagataacttgtgaaacaggaccaggttgtccttcaggc
catgctatggtcgcagcatctgtttggtttgtctttgtggcatccctcaatgaatacatc
atgtctgaggtgaggagtgtccaacgtgccaagaaagcgaccaggatcacctggacaatc
tatagcctttttatagtgcttgtgtgtgtttccagggtctacactgcaactcacttccct
catcaagttatcctgggtgcattaactggaataatagtggcagcagagaccagaaaatta
tctgtggaaaactatggatttggttcctactttctaggaggattgttcgtccttgtttca
atcttcttagaatactacctgataagtctcgttggtcttgatcctggctggtctatgaaa
cttgctttaaaacgctgtgtgtatcgggaatgggttcacatggacaccacgctcttctat
gctatttccagggacgttggtgcgttcttcttcgctggaatgatgtgcagttgcttgacg
gtgaagtatgatcgggtgagggggcagtttgcaaagaaactgactgcaactctcttaact
gtagctgctgcacacgtcatagagagcatgtacgttcccaggggatatgtcatattgttc
tacatattaggtgcattaaaatatggactagtgtcaatcagtactgtcggactcaaccaa
gctgtatccagttacggtagtcaaaaccagaatttatga

DBGET integrated database retrieval system