KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578064Help
Entry
578064            CDS       T01019                                 

Definition
glucose-6-phosphatase-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spu00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spu00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:spu04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 272 aa AA seqDB search
MIGQRPYWWVMESNVYTGEERPFLKQFKITCETGPGCPSGHAMVAASVWFVFVASLNEYI
MSEVRSVQRAKKATRITWTIYSLFIVLVCVSRVYTATHFPHQVILGALTGIIVAAETRKL
SVENYGFGSYFLGGLFVLVSIFLEYYLISLVGLDPGWSMKLALKRCVYREWVHMDTTLFY
AISRDVGAFFFAGMMCSCLTVKYDRVRGQFAKKLTATLLTVAAAHVIESMYVPRGYVILF
YILGALKYGLVSISTVGLNQAVSSYGSQNQNL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgataggacagcgtccctattggtgggtcatggagagtaatgtttacactggtgaagaa
cgtccattcctgaaacagttcaagataacttgtgaaacaggaccaggttgtccttcaggc
catgctatggtcgcagcatctgtttggtttgtctttgtggcatccctcaatgaatacatc
atgtctgaggtgaggagtgtccaacgtgccaagaaagcgaccaggatcacctggacaatc
tatagcctttttatagtgcttgtgtgtgtttccagggtctacactgcaactcacttccct
catcaagttatcctgggtgcattaactggaataatagtggcagcagagaccagaaaatta
tctgtggaaaactatggatttggttcctactttctaggaggattgttcgtccttgtttca
atcttcttagaatactacctgataagtctcgttggtcttgatcctggctggtctatgaaa
cttgctttaaaacgctgtgtgtatcgggaatgggttcacatggacaccacgctcttctat
gctatttccagggacgttggtgcgttcttcttcgctggaatgatgtgcagttgcttgacg
gtgaagtatgatcgggtgagggggcagtttgcaaagaaactgactgcaactctcttaact
gtagctgctgcacacgtcatagagagcatgtacgttcccaggggatatgtcatattgttc
tacatattaggtgcattaaaatatggactagtgtcaatcagtactgtcggactcaaccaa
gctgtatccagttacggtagtcaaaaccagaatttatga

DBGET integrated database retrieval system