KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578161Help
Entry
578161            CDS       T01019                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    578161
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     578161
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   578161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 541 aa AA seqDB search
METLRYLQIVVCLFSLSLATSQNAEFWNQEAQDSLKEAIRLTERNVNTAKNIVLFLGDGM
SIETLTAARILKGQLAGGLGEDAKLAVEDFPHFGLAKTYSTNKQVPDSAATATAYLCGVK
TKTGVLGVDDRVERGDCVSSLGGEVKSILEMAQEAGKSVGFVTTTTLTHASPGALYAKVP
DRKWQSDMDIPRGERNLGCVDMAQQFVSNNNIQVALGGGRMKFMSRINRDPEYPSMPGSR
IDGRNLIQEWINNKPDQDRAHYVWNEADFNKIDPEQTDYLLGLFEYSLMKFDIRRDNDTG
GEPSIAEMTDKAIRILSKNPNGFFLFVEGGRIDHGHHFGVANLALTETVAMDKAIDVALG
LVDTEETLVMVTSDHAHTFKMAGYSARGNPILGKSDGRSTDLGSYTTVGYMNGPGAIISS
LSYRLLGRRPPVTDANTGRPFYLPQAVVPTFLETHGGDDVAIFAIGPMSHLVHGVHEQNY
VSHVMQRAACIGYYADNCQPVQAAAGDDDFGTLSDATALRVDAKLGILLVFSVLLALVKI
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcttcgatatcttcaaatagtcgtctgtcttttctcgttaagcctcgcaact
agccagaatgctgaattttggaaccaggaggcgcaagattctctcaaggaagcgatccgc
ctgacggaacggaacgtcaacaccgccaagaacattgtcctgttcctcggcgatggcatg
agcatcgagaccttgacagctgcccgcatcctgaagggacaactcgcaggaggtttgggg
gaggatgccaaactagcagtggaggactttccacattttggcttggcaaagacatactcg
accaacaagcaggtaccggactcggctgccacggccacagcctacctgtgtggagtcaag
accaagacgggtgttctcggggtcgacgatagggtagagaggggtgattgtgtctcttcc
ctcggaggggaagttaaatccatcctggaaatggcccaagaagcagggaaatccgttggt
tttgttacgaccaccacactcactcatgcatcacctggtgccctctacgccaaagtcccg
gacaggaaatggcagtctgacatggacattcctcgcggggaacgcaacctgggttgcgtc
gacatggcgcaacagtttgtcagcaacaacaacattcaggttgccctcggaggcgggaga
atgaaatttatgagcaggatcaaccgagatccggaatatccgagcatgcctggatctcga
atagatggccgtaatttgattcaggagtggatcaacaacaaaccggatcaggaccgagcc
cactacgtctggaacgaggcggattttaacaaaatcgatccggagcaaaccgactacctc
ctcggtctcttcgagtacagcctcatgaaattcgacatccgtcgcgacaacgacacggga
ggcgaacccagcatcgccgagatgaccgacaaggccatccggatcctcagcaaaaacccc
aacggattcttcctctttgtcgaaggtggtcgtatcgaccatggacatcacttcggcgtg
gccaacctggctctgacggagacggtggcgatggacaaggctatcgacgtcgccctcgga
ttggtcgataccgaggagacccttgtcatggttacctccgaccacgcccatacattcaag
atggcgggctactcggctaggggaaaccccatattaggcaagtctgacggacggtctacc
gatttggggtcatacaccacagtcggctacatgaacggacccggtgcgatcatttcatct
ctctcctacagacttcttggacggcgccctcctgtgacggatgctaacacaggaagaccg
ttctacctgccccaggctgtcgtgccgacgttcctcgagacacacggaggtgacgatgtc
gctatcttcgccatcggacccatgtcccacctcgtacacggcgttcacgagcagaactac
gtgtcccacgtgatgcagagggcggcctgtatcggctactacgccgacaactgccagccc
gttcaggccgcggccggcgatgacgactttggcacgctctccgacgcgactgcccttcgc
gtggatgctaagcttggcattttgcttgtgttttccgtcctcttggctttggtcaagatt
gcttaa

DBGET integrated database retrieval system