KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578397Help
Entry
578397            CDS       T01019                                 

Definition
guanidinoacetate N-methyltransferase-like
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    578397
   00330 Arginine and proline metabolism
    578397
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     578397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 233 aa AA seqDB search
MADKIFSSGEDCKSSWNDAMANFNQADTHLEIMGKPVMERWETPYMHELAKVASSKGGCV
LEIGFGLAIAATKIQEAPTVTEHVIIECNDGVFDRLEEWRKTQPHTVTPLKGMWEDVVPT
LPDNKFDGILYDTYPLSDATWHTHQFEFIKNHAFRLLKPGGVLTYCNLTSWGEFMKTKYT
DIRQMFQETQVPSLCEAGFKKENISTALLPISPPKECRYYAFNHMITPTIIKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaagattttctcctccggtgaggactgcaaatcgagctggaatgatgcaatg
gcaaattttaaccaagccgacacgcacctggaaatcatgggaaagcccgttatggaaaga
tgggaaactccctacatgcatgaactggctaaagttgcttcgtctaaaggcggttgtgta
ctcgagattggtttcggactggccattgcagctaccaagattcaggaagcccccactgtc
acagagcacgttatcatagaatgtaacgatggcgtgttcgatcgcttagaagaatggcgg
aaaacccagccccatactgtgaccccgctcaaaggaatgtgggaagatgtggtgcctacg
ctaccggataataaatttgatggtatcctgtacgacacctatcccctatccgatgctacg
tggcacactcatcagtttgagttcatcaagaatcatgcgttccgattattgaaacctggc
ggtgtgttgacttactgcaacctcacctcctggggagaattcatgaagaccaagtataca
gacattcgacaaatgtttcaggaaactcaggttccttctctatgcgaggctggatttaag
aaggagaatatatccaccgctcttctacccatctcaccgcccaaagagtgccgctactat
gcctttaaccacatgatcacaccgaccatcatcaaggcatag

DBGET integrated database retrieval system