KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578573Help
Entry
578573            CDS       T01019                                 

Definition
UDP-glucuronosyltransferase 1-2-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:spu00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:spu00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spu00500]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:spu00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:spu00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:spu00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:spu00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:spu00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 522 aa AA seqDB search
MRRFLCFVLSSMIFAIDVIPLTSGADILVSVLSPMPSSHAKGISAITGALTRRGHNVTIL
TSSSAGTKGFQRNTYNRAVQYKFVDTPGAKDPLSVEALFDSRLVKQFTQVVNELAVFRRS
CQCFFEDTAALSLLEKSHFDIIIADAFDGCDAILSSYLEIPYIAVTTGVRYPFFHERLYG
IPFPSSYVPMGLLSLSDRMAFLVRVASFMEHHVIMSSLEWIHFGALNEVKDKHGIAPGRS
IPDLIGGAELWLCMTNFALDFPRPTAPNWVAIGNIADTPAKPLQKDYASFIEGSGEHGFI
IFSLGIQVTELPKEMAEDFARVLSELPQRVVWRYTGTRPRYLGNNTMLVDWMPQNDLLGH
PKARLFITHGGLNGITEAVYYAVPMVVMPIFAEQHSNAVKVEVKGMGRRLQKNSISYDSV
KMAVMDVLLNQSYRENVQRISGIYRDIQSKPDETVVYWVEHILEFGGSHLRSRALELSFI
QLHSIDVLAFIVGIIAVIVFLLCACCKRCISCCSKSKKTKLE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagacgttttctgtgtttcgttttgtcctccatgatcttcgccatcgatgtcatacct
ttgactagtggtgccgatattcttgtctccgtgttaagtccgatgccaagtagccatgcc
aaaggtatatcggccatcacaggagcactgacccgtcgcggccacaatgtgacaatcctc
accagctcttctgcaggaacaaaaggcttccagaggaacacctacaacagggctgtccag
tacaagttcgtcgataccccaggtgccaaggacccactttctgttgaagctctgttcgat
agtagactggtaaagcaatttacacaagtagtgaatgaactcgcggtgttcagacgtagc
tgccagtgctttttcgaagacactgcagcgctctctctgctcgagaaatctcactttgat
atcatcatcgcggacgcatttgatgggtgtgacgcgatacttagtagctacctcgagata
ccgtacattgcggtgacgactggagtgagatatcctttcttccacgagcgtttgtatgga
atcccgttcccgtcatcttacgttcccatgggtttgctatctctgtcagacaggatggct
tttctcgtgcgcgttgccagcttcatggagcatcacgtcatcatgagcagtctcgaatgg
atccacttcggggctttaaacgaggttaaagacaaacatggtatcgctccaggacgaagc
atcccggatcttataggtggagcagagttgtggttgtgcatgacgaattttgctttggat
ttccctcgccctaccgctcctaattgggtggctattggaaacatcgcggacacccctgcg
aagccattgcagaaggactacgcaagcttcattgaggggtcgggtgaacatggtttcatc
atattttcattgggcatccaagttactgagctacctaaagagatggcagaggactttgca
agagtcttgagcgagctaccacaaagagtcgtctggcggtatactgggacacgccctcgt
taccttggtaacaacacaatgctggtagactggatgccacaaaatgatctacttggtcac
ccgaaagcccgactcttcataacccatgggggtctcaacggcatcaccgaggcagtctac
tacgccgtccccatggtagtcatgccgatctttgctgagcagcattcaaacgctgttaag
gtcgaggtcaaaggaatgggaagacggcttcagaagaactcaatatcttatgattcggtc
aagatggcggttatggacgttcttctcaatcaaagctacagagaaaatgtccagcgaatc
tcaggaatctacagagatatccagtccaaaccggatgaaactgtggtctactgggtggaa
cacattctcgaatttggtgggtcacacctgagatctagagccttggaactcagcttcatc
cagcttcattcgatcgacgttctcgctttcatcgtcgggatcatagctgtcatcgttttc
cttctctgtgcttgttgtaaacggtgtatatcatgctgctcgaaaagcaagaaaacaaaa
cttgagtga

DBGET integrated database retrieval system