KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578606Help
Entry
578606            CDS       T01019                                 

Definition
eukaryotic translation initiation factor 3 subunit J-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    578606
Translation factors [BR:spu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    578606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 241 aa AA seqDB search
MADWEDEDFDPDAGFSKAGAAAGDKWEGEDEEENVKDDWAASDDEEKKDESSEQKSTSGD
GAFQVKKKKNTLEKALQRKAEKRKDKVEKEKIKLTPEEEMDEKLLQQKMVEEADLELAKE
AFGVGAGDGKSIDAMNPTTEEDFEEFGKLLKDKLSKLESSDYYPSLLEDVFQSCCVCLDG
EQVRKIGSSLTAIANEKTKAQKASKSKKGKKKAVLAGSGKSAKKDDFDDFGYGGDEFDDF
M
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgactgggaggacgaagattttgatccagatgcgggcttttccaaggcgggggct
gccgccggtgacaaatgggaaggagaggacgaggaagaaaatgtgaaggatgactgggct
gcatcagatgatgaagagaaaaaagatgaatcttcagagcagaagtcaacttctggagat
ggagcttttcaggtcaagaagaagaagaacacattagaaaaagcattgcaaagaaaagct
gagaagaggaaagataaggtggagaaagaaaagatcaaattgacaccagaagaggagatg
gacgaaaagttattacaacagaaaatggtagaagaggccgatcttgaactagcaaaggaa
gcttttggtgtaggggccggagatggtaaatcaatcgatgccatgaatccgacgacggaa
gaggatttcgaggaattcgggaagctattaaaagacaaattatccaaattagaatcttca
gattactatccaagtcttctagaggatgtgtttcaatcatgttgtgtttgccttgacggt
gaacaagtgaggaaaataggtagcagtttaacagcaatagcaaatgagaagacgaaagca
cagaaggcctcgaaatcaaagaaaggaaagaaaaaagcagtgctagcagggagcggaaag
tcggcgaagaaggatgactttgatgactttgggtacggtggtgatgaatttgatgatttt
atgtga

DBGET integrated database retrieval system