KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578640Help
Entry
578640            CDS       T01019                                 

Definition
patatin-like phospholipase domain-containing protein 7-like
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    578640
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     578640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1352 aa AA seqDB search
MEEDDELDMDSPLDDKGFLPPVQAQPKPRFRKRDKVMFYGRKMLRKVKSISGPVYTVQRK
MRKRKEYMDLAKTIRGILQHTDSDRKPMLQVKEPPPAILEADFRVLQLPPEFRIPTEVLY
MLKNIRVFGHFERPLFLELSRSVESKFLPAGAYLFQRGQPDDSIFVVQCGRLVVYITEPD
GSEYEVKEVTQGDSVHSLLSVLDVITGYSAPYKTVSCKAAEDTTVLRLPAVAFQAVFEQY
PESMVRVVQMMMIRLQRVTFLTLQNLLGLDAELINPVSRLMIILTLRLDNISSKSLAIHA
MNSKAGSPTKRQTSVITTPSTTAGGSSSALSTSSAETVLRVSMAEEATDVFKSARVLGPI
SNWRRATSLDVDDTGRLSMSTSDFEAAAGRARVTGLDDTKPLRQISLENAAAASSKSGGG
RKRAMSLEGVSERSSEEKKDYSEDEILEMAKRDLMTLFGLPDTSLLDHQIALSHIPGGSV
VVKEGDQETNLMFLLKGSFLMLQTDEISGKERTVFVVSHGEMIGELAVLTGEPALFTVKA
RQDCCVIAISKTRFYSIMREYPQVVLKVGHQVVKKLSSFVRQTDFALDWMQLEAGKAVYR
QGDQSQCTYIVLNGRLRSVVQLPSGKRELMGEFGRGEIVGIVEVLTLKERVTTVHAIRDT
ELAKLPTGMLNLIKRKFPHTVTRLIEILGQRLLGQVEEKMGSTKLTGKWVYQTTVENLST
VALIPGSDDVPLARFALELTHSLSAVGSVLRLTKEHILQTLGGSALDSVHEYRLTSWLGQ
QEDLHNIVLYQADKRMTAWTQRCIRQADCILIVALADRDPNNVSEMETQLEALAVRAQKE
LILLHREKDGRPPSGTAEWLNARGWCVSHHHIRCPKRMFSKRSPARVRETYDRLFDTKAD
TMSDFSRLARFLTGTSIGLVLGGGGARGISQLGIIKAMEEYGIPIDIVGGVSIGALISAL
YAEDVNSTIMEKRLQGFCKDFGSLWKRVIDLTYPSTAMFTGHNFNKSISDLFGDKQIEDL
WLPYFTISTDITKYALRLHTSGSLWRYVRASMSLSGYLPPLCDPKDGHLLLDGGYVNNLP
ADIMRAMGVPTIIAIDVGSEDTSSITNYGDELSGWWLLWKKWNPWTEPVRVPSLDEIQSR
LAYVSSMKMLDEVKNSSYCEYMRPPINNFATLAFHRHREIMEVGYHHGMTVFSGWKKSGY
LQALLSEKSSTLHKRGKPGLPNMHPRFTDLAALVTRMEPQKQAIPDPDEVDYARVEGTGD
TDVGMETDGIGTESASEMNPSSDVPNATNSETVTRSASAPSTVIGSEISSEDASEDDVEV
EVDASGSTHSSIRKKVEGLRLRRHRSESSPSE
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagacgacgaactagatatggactcgcccctggatgataagggcttcttgcct
ccagttcaagcacaaccaaagcccaggttcagaaaacgagataaagtgatgttttatggc
aggaaaatgctgagaaaggttaaatcaatatctgggccagtgtatactgttcaaaggaag
atgagaaagaggaaagaatatatggacctggcaaaaaccattagagggatcctgcagcat
acagacagtgacaggaaaccaatgcttcaagtcaaggagccccctccggccatcttggaa
gcggacttcagggtattacagctccctccagagttcagaatccctacagaggtactctac
atgctcaagaacatcagagtgtttggtcactttgagagacctctcttcttggagctcagt
cgatcagtagagagtaaattcctaccagcaggtgcgtatctattccagagggggcagccg
gatgatagcatctttgttgtacagtgtggccgtctggtcgtctacatcacagagccagat
ggatcggaatatgaagtaaaagaagtgacccagggtgatagtgtacacagtttactgagt
gtcctggatgtcatcacaggttattctgcaccatataagactgtatcatgcaaagccgct
gaagatacaactgtgctgaggctcccagctgtggcctttcaagctgtctttgaacagtac
cctgaatctatggtcagggttgtacagatgatgatgatccgtctccagcgagtgaccttc
ctcacattgcagaacctgttgggcttggacgctgagctcatcaacccagtaagtagacta
atgatcatattaacccttcgtttggacaatataagcagcaagtccttagccatccacgct
atgaacagcaaagcaggcagtccaaccaagagacagacgtccgttatcactacaccatca
accaccgcagggggatccagctcggccctttcaaccagcagcgctgagacggtcctgaga
gttagcatggcggaggaggctaccgatgtcttcaagtcagctcgagtcttaggtccgatc
agtaactggcgaagagcgacctctctggatgtggacgatacagggcgtctgagcatgagt
acttccgactttgaggctgcagcagggagagcaagggtcaccggtctagatgacaccaag
ccgctcagacagatctcattggagaatgctgccgcagcatcaagcaagtcaggaggaggt
cggaagagagccatgagcctggagggagtcagtgagagatcgtctgaggagaagaaagac
tactcggaggatgaaatcttagagatggccaagagagatctgatgacactttttggactt
ccagacacctccctgcttgaccatcaaatagctttgtctcacatcccagggggcagcgta
gtggtcaaggaaggtgatcaggaaaccaacctaatgtttttattgaaaggatcattcctg
atgctgcagactgacgagatatccgggaaggaacgtacagtgtttgtagtaagccatggt
gagatgattggtgagttagccgtcctgaccggagaaccggccctcttcacagtcaaagct
agacaggactgctgtgtgatcgctatcagcaagacaagattctacagtatcatgagggaa
tatccccaggtagtgttgaaggttggtcatcaggtggtcaagaaactctcatcctttgtg
aggcagacagactttgctttggattggatgcaactagaagctggtaaagcagtgtacagg
caaggggaccaatctcagtgcacctacatcgtcttgaatggtcgtctgaggtcagttgtc
cagctcccatccggtaagagggaactgatgggagagtttggccgtggggagatcgtgggc
atcgtagaggtgttgaccttaaaggagagggtcacgacggtgcatgccatcagagacacc
gagttggccaagctacccactggtatgctgaacctcatcaagaggaagttccctcacacg
gtgacccgtctgatagagatcctaggtcagaggttattgggtcaggtcgaggaaaaaatg
ggctctaccaagttgacgggtaagtgggtgtatcagaccacagttgagaacctgtccacc
gtggccctgatccccgggtccgatgacgtacctctggctaggtttgccctggagctgaca
cattctctcagtgctgtgggttctgttctgaggcttactaaggagcacatcctccagaca
ttaggaggttcagctcttgacagtgtccatgagtatcgtttgaccagctggctcggtcag
caggaggatcttcataacattgtcctctatcaagccgacaagagaatgactgcttggaca
cagagatgtattagacaggctgattgcatcttgattgtagctctcgctgaccgagatcca
aacaacgtgagtgagatggagacgcagctagaggctctggctgtcagggcacagaaagaa
ctcatcctactacacagagagaaagatggtaggccacctagtggaactgcagagtggctg
aatgccagaggttggtgtgtatctcaccatcatatccggtgcccaaaaagaatgttcagt
aagcgctctcctgcaagggtacgagagacctacgatcggctttttgacaccaaggcagat
accatgtccgacttctcccggctggcacgcttcttgacgggtacatccattggtctggtt
ctcggcgggggtggtgcgaggggtatatcccagctcggcatcatcaaggcgatggaggag
tacggcatccccatcgacatcgtgggcggggtcagcatcggggccctcatctcggccctc
tacgccgaggacgtcaacagcaccatcatggagaagaggctgcagggattctgcaaggac
tttggctccctctggaagagggtcatcgacctgacctacccgtccactgccatgttcaca
ggtcacaacttcaacaagagcataagtgacctgtttggtgataaacagatagaggatcta
tggctgccatacttcaccatatcaacagatatcaccaagtatgcactcaggttacacacc
agtggttcgttatggcgctatgtcagggcaagcatgtctctatcagggtatttgccacct
ctgtgtgacccaaaggacggccatctactgctggacggtggctatgtcaacaacttgcct
gctgacatcatgcgtgcgatgggggttcctaccatcatagccattgacgtaggcagtgag
gacacctccagtattactaactatggtgatgagctgtccggatggtggctgctgtggaag
aaatggaatccatggacagaaccagttagggtacccagccttgatgagatccagtcccgt
ctggcctatgtatcctctatgaagatgcttgacgaagtgaagaatagctcctactgtgaa
tatatgcggccacccatcaacaactttgctactttggccttccatcgtcatcgtgagatc
atggaggtcggttaccatcatgggatgactgtattcagtggctggaagaagtctggatac
ctccaagctctactctcggagaaatcctctacgcttcacaagcgaggaaagcctggtcta
cccaacatgcatcctcgtttcactgacctagcagcgctagtgaccaggatggagcctcag
aaacaagccattccagacccagatgaggttgactatgcaagagtagaaggtacgggtgac
accgacgtcggcatggaaacggatggcatcggaaccgaatctgcctcggaaatgaacccc
tcatcggatgttcccaacgcaacgaacagcgaaacggtgacgcggtccgcctcggctcct
agtacggtcatcggaagcgagatctccagcgaagatgcaagcgaagacgacgtcgaggtc
gaagtcgatgcctctgggtcaacccacagttctatcaggaagaaagtggagggactccgg
ctacgaaggcaccgcagtgaaagctccccctcagagtag

DBGET integrated database retrieval system