KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578655Help
Entry
578655            CDS       T01019                                 

Definition
cytochrome P450 1A1-like
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    578655
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    578655
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    578655
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     578655
Cytochrome P450 [BR:spu00199]
 Cytochrome P450, animal type
  CYP1 family
   578655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 547 aa AA seqDB search
MMLDVSATTSMNPGPQYLSQTIASYFLLVTVVILVTRVWLTESSMKMRAKSSGDEAKPLP
GPWGIPVLGNMLSLGRSAPHLSLTALAKKFGSIFQIRLGSRPVLVLNGYEAIQKALIKQA
VVFSGRPDLYTFELIKSGVKSGTSLSFGNYGESWKLHRKLAESSLRHFTAGSQVKFVESV
VSTEASELVQYFKSIACDNNNNNNNANGDQCKPRPDNVVDIRNVLRLAVSNVMCWFMFSK
RHTYEDEALLNLLNISDRFTAATGSGNPVDFMPWLRVFFRKSTNEFKSLLTEFRAFVGGN
LLEVHTAEYEDGSERDILDHLVTSGRRYNENNNKKAGINDVMLRETCFDYFGAGFETVST
TLEWCLLYMAAHPDTQRKVQEEIDTMVGQDRLPTLEDREKLPFTQSCLLEILRHATPVPF
AIPHSTTSDTVLDGYFVAKDTVVFVNLYSAHVDPQVWNEPQVFNASRFLTSDGAIDQEMK
KHVIPFSVGRRRCIGSDLARIELFFFFTIFLQNFSIEHSKDGEVSMEATDGLARRPKDLN
INLISRK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgatgttggacgtcagtgcgacaacctccatgaatccaggtccacagtacttgagccag
acgattgcgtcgtatttcctactcgtcaccgtcgtcatcctcgtcacccgggtatggcta
acagaatcatctatgaagatgagggctaagtcgagcggggatgaagccaaacctcttcca
ggtccatgggggatccctgtgcttggtaatatgctgtctcttggtcgttccgcaccccac
ctctcgctgacggctctcgcgaagaagttcggctccatctttcagattcggctcggcagt
cgcccggtgctcgttttgaatggttacgaggccatccaaaaggcgctcatcaaacaggcc
gtggtattctctggacgtcccgatctctacacttttgagctaatcaaatctggtgtcaaa
agtgggacatcgttgtctttcgggaactatggcgaatcatggaaattgcatcgaaaactc
gctgaatcctcactccgtcatttcaccgctggtagtcaggtgaagttcgttgaatcggta
gtttcgaccgaggcttcagaactcgtacagtatttcaaatctatcgcatgcgacaacaac
aacaataataacaacgcaaatggtgaccaatgcaaaccacgtccagataatgttgtcgat
atcagaaacgttctccgacttgctgtcagtaatgtcatgtgctggttcatgttcagcaaa
agacacacttatgaggacgaagccctgctgaacctacttaatatttccgaccgtttcaca
gccgctacgggaagcggcaaccccgtcgatttcatgccgtggctccgtgtctttttcagg
aaatcaaccaacgaatttaaatccttgctgaccgagttccgtgcattcgttggtgggaat
cttctcgaagtgcataccgcagaatacgaggacggttccgagcgcgacatcctcgaccat
ctcgtcacgtcaggacgacgttacaacgaaaataataacaagaaagctggcattaatgac
gtaatgctgcgcgaaacttgttttgactatttcggcgctgggtttgagaccgtttcaaca
acgctcgaatggtgcttactctacatggctgcacatccagatacccagcgtaaagtccag
gaggagattgacacgatggtgggccaagatcgactgccgacgctcgaagaccgcgaaaag
ctcccattcacgcaatcctgcctcctagaaatattgcgtcacgcgactcccgtcccgttt
gccatccctcatagcaccacctccgataccgtgctcgacgggtacttcgttgctaaggat
accgtcgtcttcgtcaacctctattcagctcacgttgacccccaggtatggaatgaacct
caagtcttcaatgccagtcgtttcctgacctccgatggcgccatcgaccaggagatgaag
aaacatgtgattccgttcagcgtcggacgcagacgatgcatcggatcggatttggcgcga
atcgaactctttttcttcttcaccatcttcctccaaaatttctctatcgagcattccaaa
gacggtgaagtgagcatggaggcgacagacggactagccagacgacccaaagacttgaat
atcaatttgatctccaggaaatag

DBGET integrated database retrieval system