KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578655Help
Entry
578655            CDS       T01019                                 

Definition
cytochrome P450 1A1-like
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:spu00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:spu00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:spu00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 547 aa AA seqDB search
MMLDVSATTSMNPGPQYLSQTIASYFLLVTVVILVTRVWLTESSMKMRAKSSGDEAKPLP
GPWGIPVLGNMLSLGRSAPHLSLTALAKKFGSIFQIRLGSRPVLVLNGYEAIQKALIKQA
VVFSGRPDLYTFELIKSGVKSGTSLSFGNYGESWKLHRKLAESSLRHFTAGSQVKFVESV
VSTEASELVQYFKSIACDNNNNNNNANGDQCKPRPDNVVDIRNVLRLAVSNVMCWFMFSK
RHTYEDEALLNLLNISDRFTAATGSGNPVDFMPWLRVFFRKSTNEFKSLLTEFRAFVGGN
LLEVHTAEYEDGSERDILDHLVTSGRRYNENNNKKAGINDVMLRETCFDYFGAGFETVST
TLEWCLLYMAAHPDTQRKVQEEIDTMVGQDRLPTLEDREKLPFTQSCLLEILRHATPVPF
AIPHSTTSDTVLDGYFVAKDTVVFVNLYSAHVDPQVWNEPQVFNASRFLTSDGAIDQEMK
KHVIPFSVGRRRCIGSDLARIELFFFFTIFLQNFSIEHSKDGEVSMEATDGLARRPKDLN
INLISRK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgatgttggacgtcagtgcgacaacctccatgaatccaggtccacagtacttgagccag
acgattgcgtcgtatttcctactcgtcaccgtcgtcatcctcgtcacccgggtatggcta
acagaatcatctatgaagatgagggctaagtcgagcggggatgaagccaaacctcttcca
ggtccatgggggatccctgtgcttggtaatatgctgtctcttggtcgttccgcaccccac
ctctcgctgacggctctcgcgaagaagttcggctccatctttcagattcggctcggcagt
cgcccggtgctcgttttgaatggttacgaggccatccaaaaggcgctcatcaaacaggcc
gtggtattctctggacgtcccgatctctacacttttgagctaatcaaatctggtgtcaaa
agtgggacatcgttgtctttcgggaactatggcgaatcatggaaattgcatcgaaaactc
gctgaatcctcactccgtcatttcaccgctggtagtcaggtgaagttcgttgaatcggta
gtttcgaccgaggcttcagaactcgtacagtatttcaaatctatcgcatgcgacaacaac
aacaataataacaacgcaaatggtgaccaatgcaaaccacgtccagataatgttgtcgat
atcagaaacgttctccgacttgctgtcagtaatgtcatgtgctggttcatgttcagcaaa
agacacacttatgaggacgaagccctgctgaacctacttaatatttccgaccgtttcaca
gccgctacgggaagcggcaaccccgtcgatttcatgccgtggctccgtgtctttttcagg
aaatcaaccaacgaatttaaatccttgctgaccgagttccgtgcattcgttggtgggaat
cttctcgaagtgcataccgcagaatacgaggacggttccgagcgcgacatcctcgaccat
ctcgtcacgtcaggacgacgttacaacgaaaataataacaagaaagctggcattaatgac
gtaatgctgcgcgaaacttgttttgactatttcggcgctgggtttgagaccgtttcaaca
acgctcgaatggtgcttactctacatggctgcacatccagatacccagcgtaaagtccag
gaggagattgacacgatggtgggccaagatcgactgccgacgctcgaagaccgcgaaaag
ctcccattcacgcaatcctgcctcctagaaatattgcgtcacgcgactcccgtcccgttt
gccatccctcatagcaccacctccgataccgtgctcgacgggtacttcgttgctaaggat
accgtcgtcttcgtcaacctctattcagctcacgttgacccccaggtatggaatgaacct
caagtcttcaatgccagtcgtttcctgacctccgatggcgccatcgaccaggagatgaag
aaacatgtgattccgttcagcgtcggacgcagacgatgcatcggatcggatttggcgcga
atcgaactctttttcttcttcaccatcttcctccaaaatttctctatcgagcattccaaa
gacggtgaagtgagcatggaggcgacagacggactagccagacgacccaaagacttgaat
atcaatttgatctccaggaaatag

DBGET integrated database retrieval system