KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579018Help
Entry
579018            CDS       T01019                                 

Definition
retinoic X receptor-like
Orthology
K08524  
retinoid X receptor alpha
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Transcription factors [BR:spu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    579018
Nuclear receptors [BR:spu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   579018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 479 aa AA seqDB search
MDNMPDLDAMKSLGMQLPTSTMGSPSMVNQGLGSPTLSSPGLHSGITDYHLDRVDRVWDR
RPEGHGLHSPPMQSPTLSSQGSMEDIKPIITSQPGSLPLSQSQVSSMTGMHSPLNINVQF
PRDILHLNVQGHLHNPFSQPAQSSISPGSMPGTSINKSICAVCGDRASGKHYGVYSCEGC
KGFFKRTVRKDLTYTCRDDRNCMVDKRQRNRCQYCRYQKCLGMGMRREAVQEERQRKDKP
TGDSQVESTSGTSNDMPVEKILDAELAVEPNNGPYVDTPRDPVTNICQAADKQLFTLVEW
AKRIPHFTELPLDDQVTLLRAGWNELLIAAFSHRSIQVKDGILLATGLHVHRNSAHSAGV
GTIFDRVLTELVAKMREMKMDKTELGCLRAIVLFNPDAKNLTSVQKVEELREKVYASLEE
YCRNQYTDEPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPNNS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggataatatgccagatttggacgctatgaagtccctcggtatgcagttaccaaccagc
accatgggttccccctccatggtgaatcagggtctcggctcacccacactctcctcacct
ggtctacactcaggaatcacagattaccatttggatagagttgacagggtgtgggacaga
agacctgagggtcatggtctacactctccgcccatgcagtcaccaaccctgagcagccag
ggctcaatggaagatatcaaaccaatcatcacctctcaaccaggatccttacccctctca
caatcacaggtgtccagtatgacgggcatgcactcccccctcaacatcaacgtccagttt
ccccgggacattttacatctcaacgtgcagggccacttacacaaccccttctcacagcca
gcgcagtcgtcaataagccctggctccatgcccggcacatccatcaacaagagcatctgt
gcagtgtgcggagacagagcatcaggcaaacattatggagtctacagttgtgaaggttgc
aaagggttcttcaagaggacggtacggaaagacctcacgtatacctgtcgggacgatcgt
aactgtatggtcgacaagagacagagaaatcggtgccaatattgccgctatcagaagtgc
ctgggcatgggcatgcgcagagaagctgtacaagaggagcggcaacgcaaagacaagccc
acaggtgacagtcaggtagagagcacaagtggaacaagtaatgacatgcctgtggaaaag
atcttggatgccgaactagcagtagaacctaacaacggcccctacgtagacaccccgcgt
gaccctgtgacaaacatttgccaagctgccgacaaacaactctttaccctggtagaatgg
gccaagcgaatcccacacttcacagaactgccactggatgatcaggtcacgctcctcagg
gcagggtggaacgagctgttgattgcagccttctcacatcgctccatccaagtgaaggat
ggcatcctccttgccaccggcctccacgtccaccgtaacagcgcccacagtgcaggggtg
ggcacaatctttgacagggtcctcaccgagctggtggctaagatgagagaaatgaagatg
gataagacagagcttggctgtctcagagcaatcgtgcttttcaacccagatgccaagaac
ttgacctcggtacagaaagtggaggagctacgggagaaggtgtacgcctctcttgaggaa
tactgccgcaaccagtacacggacgaacccggccgcttcgccaagctgctcctcagactg
cctgccctgcgctccatcggtctcaaatgcctggagcatctcttcttctttaagctcatc
ggagacacgcccatcgacacgttcctcatggagatgctggaggcacccaacaacagttga

DBGET integrated database retrieval system