KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579102Help
Entry
579102            CDS       T01019                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00562  Inositol phosphate metabolism
spu01100  Metabolic pathways
spu04070  Phosphatidylinositol signaling system
spu04933  AGE-RAGE signaling pathway in diabetic complications
Module
spu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    579102
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    579102
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    579102
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     579102
Membrane trafficking [BR:spu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    579102
 Endocytosis
  Macropinocytosis
   Phospholipase C
    579102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 PI-PLC-Y PI-PLC-X C2 SH3_1 SH3_9 SH3_2 PH SH2_2
Motif
Other DBs
NCBI-GeneID: 579102
NCBI-ProteinID: XP_011667788
Position
Un
AA seq 942 aa AA seqDB search
MGCRCLELDCWDGPDGLPIIYHGHTLTTKIRFYDVLKTIKEHAWITTDFPIILSIENHCS
LLQQRNMACLFQEVFGDTLLTQPIDRDAASLPAVSKLKRKIILKHKKLPDNGNETFTVPT
EDSLDFDLRNSTKNGILLLEDPLDQEWAPHYFVLTDTKLYYSEETNTQANQDDDDDASSI
EPVTPNEELHYSEPWFHGKLNTNADQLPRMVAEELLTRYQQGDGTFLVRESETFKGDYSL
SFWANNRVNHCRIRSKSVHGKTCYYLVENLPFPNLYTLVNVYRERSIKGGNGITVKLKET
VPQLYGHENAEWFHSQLSRHEAEDMLKRVRQDGAFLVRKSERESDAFAISFRADGKIKHC
RIKQEGRLFTIGSAQFESLAELCSYYHKYPLYRKMKLKAPVNQEVVDRVGGDLDPEDDPI
YGSGGIYMDPNQFVPKVTVKALYDYKAQREDELSFCKHAIITNVDKQDHGWWKGDYGGKK
NMWFPSNYVEEVTTPANNDQGQNATLLGNLQKGAVDITGCSVEMMLGVRSRQHFVFRIIS
PGQRNAMDVAASDLGELENWMKCIQEASVQAKVRSKESAIHERRLRIAREFSRLIVYCRS
VPFSEERIPGKYFEMSSFPETKVERYMCAGKSKVLLDYNRKQVSRTYPKGQRIDSSNYDP
IPIWFCGCQMVSLNYQTPDRHMQVNEGMFQLNGRCGYVLKPECMFDKNFDSFDKRTLVDV
DPIHLTITIIAARHLQKTGRGIASPFVEVEILGSDYDSGNKYKTSTKADNGFNPVFNEVC
EFDVTNPDLAMLRFVIQDEDVFGEPNFLGQATYPLKAIRTGYRSVQLKNGNSEELELATL
LVHVERRVIGECDDSDLYASIQMLRERTQELTAVVNTMDRPEIDVSAAAGGGSDSDACRL
KTAELNKCQEALFHLQEQRKQRVEKRRLKKTASNSQSRLPRP
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgggatgcagatgtctagaattggactgttgggatggaccagacggtctaccaatcatc
taccatggtcacaccttgaccaccaagatcaggttctatgatgtactcaagacaatcaaa
gaacatgcttggatcaccacagactttcccattatcttatccattgagaatcattgctca
ctactacaacagagaaacatggcctgcctcttccaagaagtctttggtgacaccttactc
acacagcccattgacagggatgcagccagccttcctgctgtcagcaagctcaagaggaag
atcatcttgaaacacaagaagcttcctgataatggaaatgagacattcacagttcccaca
gaagacagtctagactttgacttgagaaattcaaccaaaaatggcattctccttcttgaa
gatccactagatcaagaatgggctcctcattactttgtgctgactgacaccaagctgtac
tactctgaggagactaacacgcaggctaaccaagacgatgatgatgatgctagctccata
gaaccggtcacgcccaacgaagagcttcattactcggagccctggtttcacggaaaactg
aacacgaacgccgaccagctacctcgcatggtcgcggaagaactcctcacacgttatcag
caaggcgatggcactttcctcgttcgtgaaagcgagacgttcaaaggagactactccctc
tctttctgggctaacaatcgcgtcaatcactgccgtattcgctccaagtccgtccacggc
aaaacttgctattacctggtcgaaaaccttccgttcccgaacctctataccctcgtaaac
gtctaccgcgaacgctcgatcaagggcgggaacggcatcacagtgaagttaaaggaaacg
gtgccccagctgtatggccacgagaatgcagaatggttccatagtcaactgagcagacac
gaggcggaggacatgttgaagagagtccgtcaggatggtgctttcctcgtcaggaagagc
gagagagaaagtgatgccttcgccatctcattcagagctgatggcaagatcaagcattgt
cgtatcaagcaggaaggtcgactctttacgatcggcagcgcccagtttgagagcctggcg
gagctctgcagctattatcacaagtaccccctctataggaagatgaagttaaaggctccc
gtcaaccaagaggtggtagatagagtaggaggggatttggatccagaagatgatcctatc
tacggcagtggaggaatctacatggatcccaaccagtttgtaccaaaggtgactgtgaaa
gcattatacgactacaaggcccagcgagaggatgagctctccttctgcaaacatgctatc
attaccaatgtggataagcaagaccatggatggtggaaaggagactatggcgggaagaag
aacatgtggtttccttcaaattatgttgaggaggtcacgacccctgcaaacaacgatcag
ggacagaatgcaaccctgctaggcaacctgcagaaaggcgctgtggatatcactggatgc
agtgttgaaatgatgctcggagtgagatcaagacagcatttcgtcttcagaataatctca
ccggggcagcgcaatgccatggatgtagcagccagcgatctaggagagctagagaattgg
atgaagtgcatacaggaagcttcagtccaagcaaaagttaggagcaaagaaagcgcaatt
catgagcgtaggcttcgcatcgcaagggaattctccaggctcatcgtctactgcagatca
gttcctttctcagaagagagaattccaggcaaatactttgagatgtcgtcctttcctgaa
accaaagtagagcgttacatgtgcgccggcaaatcaaaggtcctcctggactacaacagg
aaacaggtcagcaggacgtaccccaaaggtcaacgtattgactcgtccaactatgacccc
atcccaatctggttttgcggctgtcagatggtttccctcaactaccagacaccagatcgt
cacatgcaggtgaatgagggcatgtttcaactcaacggcaggtgtggctatgtactcaaa
ccagagtgcatgtttgacaagaactttgattccttcgacaaacgaacgctagtcgatgtt
gatcccatccatctgaccatcacaatcatagcagctcgtcatctacagaagacaggacgt
ggtatagccagtccatttgttgaggtggagattcttggatcagactacgacagtgggaac
aaatacaagaccagcaccaaagcggataatggtttcaacccagtcttcaatgaggtgtgt
gagtttgatgtgaccaacccagatctggctatgctaaggtttgtcatccaggatgaagat
gtctttggtgaaccaaactttctgggccaggcaacctaccctctcaaagctatcagaaca
ggatatcgctctgttcagctgaagaatggtaactctgaagagctggagctagccactctc
ttggttcatgtggagaggagagtcattggggagtgcgatgacagcgacctctacgcatcc
atccagatgttgagggagcgcacacaggagctgacagcagtggttaacaccatggacaga
cctgagattgacgtcagtgcagcagcagggggcggatctgattcagatgcttgccgcctg
aagacggcagagctcaacaaatgtcaagaagccctcttccatctccaggagcagaggaag
caacgagtggagaagaggaggctaaagaaaacggccagcaacagccagagtcgacttccg
agaccctaa

DBGET integrated database retrieval system