KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579122Help
Entry
579122            CDS       T01019                                 

Definition
(RefSeq) extracellular signal-regulated kinase 2
  KO
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     579122
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   579122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 618 aa AA seqDB search
MTSEVEEHVMAKYEIKKRLGKGAYGIVWKAIDRRTREVVALKKIFDAFRNQTDAQRTFRE
IMYLQEFSDHKNIVKLLNVMRAENDKDIYLVFEYMDTDLHAVIKKGGILKDIHKRFIMYQ
LINATMYMHSGNVIHRDQKPSNILLDTECFVKVADFGLARSITQIDAVLSEDNPALTEYV
ATRWYRAPEILLASKRYTKGVDMWSVGCIIGELLKGKPMFPGSSTFNQLERIMAIIDPPT
KKDIEAIQSDYGATFVDMSKLRHRQSIEEVLPGAPADAIDLVRKLLHFNPDKRLTAKQAL
SHPYVARFRNKPGEIFLDYDVVPPLDDDVQLSVNEYRSKLYEMMKEKKARHRQQLREAQQ
AQRRGSQSSTPPSEQGSPMVNGSTASARSNQAASSRGTSRQRPAAAVGPGGAAAAPQAPT
STTYTNYAAEARKHRPPLSSASGNGHTPNKRLHHTSSAPVLHAGVAFGRSTADPPPVAMQ
RKNSVRQNLQRQNSVENIAAGQYNGNENQYQSSGIGQQRPSSGHHQRTRSFSAGIRNSTI
TRDTKGQHGGSLAVSSSRLVPAQRPISAQESRHAQPAGRKQFGSKTSGSSGAPRSTFGSY
SQAHGTISASSLAKLQGR
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagaagtggaagaacatgtcatggccaaatatgaaatcaagaagcgccttgga
aaaggagcatatggcattgtatggaaggccatcgataggagaacgagggaagttgttgca
ttaaaaaagatttttgatgccttcagaaatcagacagatgcacagaggacatttcgagaa
atcatgtatcttcaggaattcagtgaccataagaatatagtcaagttactgaatgtgatg
agagcagagaacgataaagacatctacctcgtatttgagtacatggacaccgatctccat
gccgtaatcaagaaaggaggaatcttaaaggacattcacaaacgttttatcatgtatcag
cttattaatgctaccatgtatatgcattctggaaatgtcatacacagagatcaaaagcca
tcaaacatcctgctagacacagagtgctttgtgaaggtagcagactttggtctcgcccgt
tcaataacccaaatagacgctgtcctgagcgaagacaatcctgcccttacagagtatgtg
gcaacaagatggtacagagcaccagagatccttctagcttcgaaaagatataccaaggga
gtagacatgtggagtgtaggctgcatcattggagagcttcttaaagggaagcccatgttt
cctggttcatctacattcaaccagctggagagaatcatggccatcattgacccgcccacc
aagaaagacatcgaggctatccaatcagactatggagctacgtttgtagatatgtcaaaa
ctcaggcatagacaatcaattgaggaagtactaccgggtgccccggccgatgcaatagat
ttggtcagaaaactgttacatttcaacccagacaagagactcactgccaaacaagctctt
tcacatccatatgtagcaagatttcgaaacaaacctggagagatatttctagactatgat
gtagtcccacccttagatgatgatgtgcagctctccgttaacgaatacaggtcaaagcta
tacgagatgatgaaagagaagaaagcccgacaccgtcagcagctgagggaagcccagcaa
gcccagaggagggggagccaatcctcaaccccaccctcagagcagggtagtcctatggtc
aatggctctacagcctcggcccggtctaaccaggctgcaagcagcagaggtaccagtcga
cagagacccgctgctgctgtcggacctggaggagcagcagcagcacctcaagcaccaacg
tcaacaacatacacaaattacgcagccgaggcaaggaaacatagaccccccttgagctct
gcctctgggaacggacacacccccaacaagcgcctacaccatacctccagtgcccccgtg
ttgcacgcaggtgtagcctttgggaggtcaacagcagacccacctcctgtggccatgcag
aggaaaaactcagtcagacaaaacttacagagacaaaatagtgtagagaacattgctgca
ggtcagtacaatggcaatgagaaccagtaccagtcatcaggcattggtcagcaacgtcca
tcatctggtcatcaccagcgcaccaggtcattctcagctggcatacgcaatagcaccatc
actagggataccaagggtcagcatggagggagtctagccgtgtccagctcaagactagtc
ccagcacagaggcccatctcagcccaagagagccgacatgctcaaccagcaggtcgtaaa
cagtttgggtcaaagaccagcggttcctcaggagcaccacggtccacgtttggcagctac
agccaagcccatggtacgatatcagcaagtagtttggctaagctgcagggaaggtag

DBGET integrated database retrieval system