KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579154Help
Entry
579154            CDS       T01019                                 

Gene name
usp32
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 32
  KO
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     579154 (usp32)
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   579154 (usp32)
Ubiquitin system [BR:spu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    579154 (usp32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1740 aa AA seqDB search
MGNKESKPSVIPYEEALKKVSEDELKRLREAFKRYSIPAGYMSKLIFVKDVMGDAMPQKL
GEHLFFSFGGTNKGITFKDLFCGLVLLTRGRQAEKLRFIFGMCANQENGTYVTRMDLNNF
IAACDGNAPAADTVQLFRESDRVSYEQFCSWLMKNSDVMKLSAWLLQDSAKQGLRLSDES
DTPTFYQTLAGVTHLEEADIIELEKKYWVLQAQSKSGRLDLDTFTPLIAPPMPAELVEGV
FNAFDENQDNHIDLKEMACGLSACCRGPLPERQKFYFKIFDADRDGRLSKTELERMCTAL
LNVRRESRVGLEIDFKAVENLNPVDIAGDIMSKHAGDSEQGITAEEFQVWAVKNSLPDDF
NKLLFQICHIILGLRPQSTVEEKEVIMGWVERERRRGLRPAQTWYLISAHWWKGWSDYVN
YRPTSSSGQQTSRHAGVQTSLSALSPNHTTSSPSFTRRTQVNGGQAWGDNYRQSHSSPSS
PSSNQNATTGSRPGTSHSLPRHASLGGSTSSVKPLQHASSFNSSSPSRKRPGHAVAVPTN
SIPCKPGPIDNTSLVAADNKKQVSTLTNEGGRLRRHPPISQNKDYEIIPDPVWKALALWY
AGGPALPRNVIVQPTTQGNTSCKLELYPLCVKLLRHQTPQVKQNGWSGVNLGLGNISLSS
SGLGINISGNSGTPQAPKRYQAYVACFSKMHTLQQVHDFLSARLRVRTEEMRLWNLKDEN
NPVVLEEDSSTLDQLGIADEQSLLIEIRNKDLSWPEEMSLLAKKKADRQSSVRTDKGVTG
LSNLGNTCFMNSAVQCISNTQPLRLYFQTKSYLYELNPTNPLGMKGHLAKRYGDLCNDLW
SGTARSIAPLKLRWTIAKYAPRFSGFQQHDSQELLAFLLDGLHEDLNRVHEKPYVELKDS
DGRPDEEVATEAWENHLIRNKSVIVDLFQGQLKSQVRCKTCGHISVRFDPFTFLSLPLPM
ESSMHVEIVVVRLDGSVPVKYGLXLNPDDTESLEEAAADLCDWGSRSNSSGRRLRGAMVR
SFPSEAQKIRTMLGGILYAYEVPQTSLSSGICKSASQGSIGSETNASQTAMMNSESNQQQ
PLPPIDTVTKENTGVHRLPANGDIPRADRVSPIPSTDSPGGGEKRRRLENGTTAKDDMDN
DTPTSSPPESMVSSGHSPSTPSQSRVLQAQHSRTPSTASGTSAVTISPVMPGAEFDGFVV
AMHRKMIRMDMYFLAWQKSRPCLFGLPLILPCQPSTTREDLYKVVWTQISRLVSPTKPTD
HNTGHNKNHAEDCDSPRQKYPFTLKAVLKDGLTCAWCPWYRFCRGCDIPCESEALKTGLA
YIAIEWDPTALHLRYQNSQERFVTEHESCENSRRLQTEPINLDDCLRAFTKEEELGEDEL
YYCSKCKQHRLAAKKLDIWRLPPILIVHLKRFQSVNGRWVKSQKIVKFPKRNFNVSNFVV
PKGDTEPRIIDVTNDAPAETEDLKDSSVLGPQAGININAIEMSSEGAGQGRVDSGRGSSV
VVNGDTDHSDMEDPAQSEDPAPSEDGAVEKSKDRRERPAALRLDTSGGALPLMNGDCKSD
IVNGHGEGEEEGGDGEEGGAKDQDSGYGTLESGQGDGSHSQSGSNSPSKPKLKKQASLLT
PPVDATGSHPLLHPQTKPEEDVDDGQMYDLYGVVSHTGILGGGHYVSYSVNPNKKWYCYN
DSSVKEVKEEIDMDNAYMLFYECRSMSYVQYIPDTSGKHPDMTTIEDEIEADYRKFCVIQ
NT seq 5223 nt NT seq  +upstreamnt  +downstreamnt
atggggaataaggagtctaaaccctcggttataccttacgaggaggcactgaaaaaagtg
tccgaggatgagttgaagagattaagagaggcgttcaaacgctactccatcccggcaggc
tacatgagcaaactcatcttcgtcaaagatgtcatgggagatgcaatgccccagaaactt
ggcgagcatctattcttttcttttggtgggacaaataaaggaattaccttcaaggatttg
ttttgtggacttgtcttgctgacgagagggagacaggccgaaaaactcagatttatattt
ggaatgtgtgcgaaccaggagaatggcacgtacgttacgaggatggatctcaacaacttc
atcgccgcctgcgatggtaacgccccagctgcagacactgtgcaattattcagagagtct
gatcgggtctcctatgaacaattctgtagctggttgatgaagaacagtgatgtgatgaag
ctttcggcatggttactacaggacagtgccaaacaaggtctgagactatcggatgagagt
gacacgcccaccttctaccagacattagctggagttacgcacttggaagaggcagatatt
attgaactggagaagaagtactgggtactacaagcacaatccaagtcaggcagactggat
cttgataccttcactccactcattgccccacccatgcctgcagaacttgtggaaggtgta
ttcaatgcatttgatgagaatcaagacaatcatatagacttaaaggaaatggcctgtgga
ctgtcagcctgctgcagaggaccactgcccgagagacaaaagttctacttcaagatcttt
gatgcggaccgtgacgggagactgtccaagacggagctggagaggatgtgcacggcgctg
ctcaacgttcgtcgagaatcgagggtggggcttgagattgacttcaaagccgtagagaac
ctgaaccctgtggatatcgctggagacatcatgtccaagcatgcaggagacagtgagcaa
ggtatcactgctgaagagttccaggtgtgggctgtcaagaacagccttccagatgacttc
aacaagttactcttccagatctgtcacatcatacttggtctaagaccgcagagtacggtg
gaagagaaagaggtgatcatggggtgggtggagagagaaaggagaagaggactcagaccg
gcgcagacttggtacctcatctcagctcactggtggaaaggctggagcgactatgtcaac
tacaggcctaccagcagcagtggccaacagacgtcaagacacgctggtgtccagaccagc
ctgtccgccctatcacctaaccacaccacctcatcaccatccttcacccgtcgcacccag
gtcaatggtggccaggcatggggcgacaactaccgccaatctcactcctctccctcctcg
ccgtcgtccaatcagaacgccacgaccggctcgcggcccggcacatctcactcgctcccg
cgccacgcttcgttgggtggatctaccagcagcgtgaagccactgcagcatgcgtcatca
ttcaacagctccagcccttcaaggaagaggcctggacatgctgtagcggttcctaccaac
tccatcccctgtaaacccggccccattgataatacatctcttgtagcagctgataataaa
aagcaagtatccaccctgaccaatgagggcggtagactcagacggcatcctccaatctct
cagaacaaagactatgaaatcatccctgaccctgtctggaaagccctagctctgtggtat
gcaggaggaccagctcttcctagaaatgtgatcgttcagccgacgacacaaggcaataca
tcctgcaagctagaactgtaccctctgtgtgtgaagttattgagacatcagacccctcaa
gtcaagcagaatggttggagtggtgtcaatcttggattaggcaatatatcactgagttcc
tcaggactcggtatcaacatctcagggaacagcggtaccccccaagctcccaaacgctac
caggcgtacgtggcatgcttcagtaagatgcacacgctccagcaggtccatgacttctta
tcggcgaggttaagggtcaggacggaggagatgaggttatggaacctcaaagacgagaac
aaccctgtagtccttgaagaggattccagcacgttggatcagctcggcattgccgatgag
cagagcttactgatagagatcaggaataaggatctcagctggcccgaagagatgtcatta
ttagccaagaagaaagcagataggcaatcgagtgtgcgaacagataaaggtgtgaccggt
cttagtaaccttggtaacacgtgtttcatgaattcagccgtccagtgtatcagcaacacc
cagcctctcagactatacttccaaactaagtcttacctctatgaactcaaccctacaaac
cctctggggatgaaaggtcatcttgccaagagatatggtgacctttgcaatgacctttgg
tcaggtacagcgcggagtatagcacctctcaaactcaggtggacgatagccaagtatgca
cctcgcttcagtgggttccagcagcacgactcgcaggagttattagctttcttactggat
gggttacatgaagacttgaacagggtgcatgagaagccatatgtggagctcaaagacagc
gatggaaggccggatgaagaagtcgcaacagaggcttgggagaaccacttaatcaggaac
aagtctgtgattgttgacttgttccaaggccagctcaagtctcaagtccggtgtaagaca
tgcggtcacatcagcgtgaggtttgatcccttcaccttcctatccctgcctctccctatg
gaaagctccatgcatgtagagattgtggttgttcgccttgatggaagcgtacctgtcaag
tatggtttgngactgaacccagatgacacagagtctttggaagaagcagctgctgacctg
tgcgactggggatcaagatcgaactcgtctggccgtagattgcgaggagctatggtcagg
agttttccgtccgaggcgcagaagattcgcacgatgctagggggcatcctgtacgcttac
gaagtacctcagacaagcctgtcgtcggggatctgcaaatcagcaagtcaaggatccatt
ggatcagaaaccaatgctagccaaactgccatgatgaattccgagtccaaccagcagcaa
cctcttcctcccattgatacggtaaccaaggagaatacaggagtacacagactacctgcc
aacggggacatccccagggccgatagggtgtcaccgatcccctcgaccgattcaccgggg
ggtggggagaagagaagaagattggaaaatggaaccactgccaaagatgacatggataat
gacacaccaacaagcagtccccctgagtctatggtcagttctggtcactcaccgtccact
cccagtcagtcccgtgtccttcaagcccagcacagccggacgccaagcactgccagtggt
accagtgcggtcaccatctcccccgtcatgccaggggcagagttcgatggcttcgtggta
gccatgcatcggaaaatgattcggatggacatgtacttcctagcgtggcagaagagtcgt
ccgtgtttgtttggtctgcctctcatcctgccctgccagccctccacgaccagagaagac
ctgtacaaggtggtctggactcagatctcaaggctggtcagtcctaccaaaccaactgac
cataacaccggtcataacaagaaccatgctgaagactgcgacagccctcgtcagaagtac
ccgtttacactgaaggcagtgctgaaggacggcttgacatgcgcctggtgcccgtggtat
aggttctgcagaggatgtgatataccttgtgaaagtgaagctctgaagacgggcttagcc
tacatagccattgaatgggaccctacagctctacatctcagataccagaactcacaagaa
aggtttgtgactgagcatgagagctgcgagaacagccgacggctacagacggagcccatc
aacctggatgattgtttacgagcgttcaccaaggaagaggagctgggggaggacgaactg
tactactgctcaaagtgtaagcagcatcggctagcagccaagaaactggatatatggagg
ctaccacctatcttgattgtacacttgaagagattccagtctgtgaatgggagatgggtg
aaatcccaaaagattgtcaaatttccgaaaagaaacttcaatgtgagtaactttgtggtt
ccgaagggggacactgagcccaggataatagacgtaacgaacgatgcacctgcagagacg
gaagatctcaaagattcaagcgtactaggtccccaggctggtatcaacatcaatgccatc
gagatgagtagtgagggggcagggcaggggcgagtggacagtgggagggggagcagcgtg
gtcgtcaatggagacacggatcattcagacatggaagaccccgcccaatcggaagacccc
gccccatcggaggacggagctgtggagaagagcaaagacagacgagagagaccggctgcg
cttcgtctggatacgtcgggcggggctctgcctctgatgaatggtgactgcaagtcagac
attgtgaatggacacggagagggagaggaggagggtggggacggggaggagggcggggcc
aaggatcaggatagtggttacggaacgctggagagcgggcagggtgatggttcacacagc
caatcagggtctaactcaccgagcaaacccaagttaaagaagcaggcttcattattgact
ccgcccgttgatgctactggatctcatcctcttcttcatcctcaaaccaaaccagaggaa
gacgtggatgatgggcagatgtacgatctctatggagttgtgagtcatactggtatcctt
ggtggaggtcattatgtttcttactctgttaatccaaacaagaagtggtactgctacaat
gatagcagtgtgaaggaggtgaaagaggagattgacatggacaacgcatacatgctcttc
tacgaatgccggtccatgtcttacgtacagtacatacccgacacgtcggggaagcacccg
gacatgacgacgatagaggacgagatcgaagccgattaccgcaagttctgcgttatccaa
tga

DBGET integrated database retrieval system