KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579154Help
Entry
579154            CDS       T01019                                 

Gene name
usp32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     579154 (usp32)
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   579154 (usp32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1718 aa AA seqDB search
MGNKESKPSVIPYEEALKKVSEDELKRLREAFKRYSIPAGYMSKLIFVKDVMGDAMPQKL
GEHLFFSFGGTNKGITFKDLFCGLVLLTRGRQAEKLRFIFGMCANQENGTYVTRMDLNNF
IAACDGNAPAADTVQLFRESDRVSYEQFCSWLMKNSDVMKLSAWLLQDSAKQGLRLSDES
DTPTFYQTLAGVTHLEEADIIELEKKYWVLQAQSKSGRLDLDTFTPLIAPPMPAELVEGV
FNAFDENQDNHIDLKEMACGLSACCRGPLPERQKFYFKIFDADRDGRLSKTELERMCTAL
LNVRRESRVGLEIDFKAVENLNPVDIAGDIMSKHAGDSEQGITAEEFQVWAVKNSLPDDF
NKLLFQICHIILGLRPQSTVEEKEVIMGWVERERRRGLRPAQTWYLISAHWWKGWSDYVN
YRPTSSSGQQTSRHAGVQTSLSALSPNHTTSSPSFTRRTQVNGGQAWGDNYRQSHSSPSS
PSSNQNATTGSRPGTSHSLPRHASLGGSTSSVKPLQHASSFNSSSPSRKRPGHAVAVPTN
SIPCKPGPIDNTSLVAADNKKQVSTLTNEGGRLRRHPPISQNKDYEIIPDPVWKALALWY
AGGPALPRNVIVQPTTQGNTSCKLELYPLCVKLLRHQTPQVKQNGWSGVNLGLGNISLSS
SGLGINISGNSGTPQAPKRYQAYVACFSKMHTLQQVHDFLSARLRVRTEEMRLWNLKDEN
NPVVLEEDSSTLDQLGIADEQSLLIEIRNKDLSWPEEMSLLAKKKADRQSSVRTDKGVTG
LSNLGNTCFMNSAVQCISNTQPLRLYFQTKSYLYELNPTNPLGMKGHLAKRYGDLCNDLW
SGTARSIAPLKLRWTIAKYAPRFSGFQQHDSQELLAFLLDGLHEDLNRVHEKPYVELKDS
DGRPDEEVATEAWENHLIRNKSVIVDLFQGQLKSQVRCKTCGHISVRFDPFTFLSLPLPM
ESSMHVEIVVVRLDGSVPVKYGFWFFLPPSFIFSFRHSSFPSEAQKIRTMLGGILYAYEV
PQTSLSSGICKSASQGSIGSETNASQTAMMNSESNQQQPLPPIDTVTKENTGVHRLPANG
DIPRADRVSPIPSTDSPGGGEKRRRLENGTTAKDDMDNDTPTSSPPESMVSSGHSPSTPS
QSRVLQAQHSRTPSTASGTSAVTISPVMPGAEFDGFVVAMHRKMIRMDMYFLAWQKSRPC
LFGLPLILPCQPSTTREDLYKVVWTQISRLVSPTKPTDHNTGHNKNHAEDCDSPRQKYPF
TLKAVLKDGLTCAWCPWYRFCRGCDIPCESEALKTGLAYIAIEWDPTALHLRYQNSQERF
VTEHESCENSRRLQTEPINLDDCLRAFTKEEELGEDELYYCSKCKQHRLAAKKLDIWRLP
PILIVHLKRFQSVNGRWVKSQKIVKFPKRNFNVSNFVVPKGDTEPRIIDVTNDAPAETED
LKDSSVLGPQAGININAIEMSSEGAGQGRVDSGRGSSVVVNGDTDHSDMEDPAQSEDPAP
SEDGAVEKSKDRRERPAALRLDTSGGALPLMNGDCKSDIVNGHGEGEEEGGDGEEGGAKD
QDSGYGTLESGQGDGSHSQSGSNSPSKPKLKKQASLLTPPVDATGSHPLLHPQTKPEEDV
DDGQMYDLYGVVSHTGILGGGHYVSYSVNPNKKWYCYNDSSVKEVKEEIDMDNAYMLFYE
CRSMSYVQYIPDTSGKHPDMTTIEDEIEADYRKFCVIQ
NT seq 5157 nt NT seq  +upstreamnt  +downstreamnt
atggggaataaggagtctaaaccctcggttataccttacgaggaggcactgaaaaaagtg
tccgaggatgagttgaagagattaagagaggcgttcaaacgctactccatcccggcaggc
tacatgagcaaactcatcttcgtcaaagatgtcatgggagatgcaatgccccagaaactt
ggcgagcatctattcttttcttttggtgggacaaataaaggaattaccttcaaggatttg
ttttgtggacttgtcttgctgacgagagggagacaggccgaaaaactcagatttatattt
ggaatgtgtgcgaaccaggagaatggcacgtacgttacgaggatggatctcaacaacttc
atcgccgcctgcgatggtaacgccccagctgcagacactgtgcaattattcagagagtct
gatcgggtctcctatgaacaattctgtagctggttgatgaagaacagtgatgtgatgaag
ctttcggcatggttactacaggacagtgccaaacaaggtctgagactatcggatgagagt
gacacgcccaccttctaccagacattagctggagttacgcacttggaagaggcagatatt
attgaactggagaagaagtactgggtactacaagcacaatccaagtcaggcagactggat
cttgataccttcactccactcattgccccacccatgcctgcagaacttgtggaaggtgta
ttcaatgcatttgatgagaatcaagacaatcatatagacttaaaggaaatggcctgtgga
ctgtcagcctgctgcagaggaccactgcccgagagacaaaagttctacttcaagatcttt
gatgcggaccgtgacgggagactgtccaagacggagctggagaggatgtgcacggcgctg
ctcaacgttcgtcgagaatcgagggtggggcttgagattgacttcaaagccgtagagaac
ctgaaccctgtggatatcgctggagacatcatgtccaagcatgcaggagacagtgagcaa
ggtatcactgctgaagagttccaggtgtgggctgtcaagaacagccttccagatgacttc
aacaagttactcttccagatctgtcacatcatacttggtctaagaccgcagagtacggtg
gaagagaaagaggtgatcatggggtgggtggagagagaaaggagaagaggactcagaccg
gcgcagacttggtacctcatctcagctcactggtggaaaggctggagcgactatgtcaac
tacaggcctaccagcagcagtggccaacagacgtcaagacacgctggtgtccagaccagc
ctgtccgccctatcacctaaccacaccacctcatcaccatccttcacccgtcgcacccag
gtcaatggtggccaggcatggggcgacaactaccgccaatctcactcctctccctcctcg
ccgtcgtccaatcagaacgccacgaccggctcgcggcccggcacatctcactcgctcccg
cgccacgcttcgttgggtggatctaccagcagcgtgaagccactgcagcatgcgtcatca
ttcaacagctccagcccttcaaggaagaggcctggacatgctgtagcggttcctaccaac
tccatcccctgtaaacccggccccattgataatacatctcttgtagcagctgataataaa
aagcaagtatccaccctgaccaatgagggcggtagactcagacggcatcctccaatctct
cagaacaaagactatgaaatcatccctgaccctgtctggaaagccctagctctgtggtat
gcaggaggaccagctcttcctagaaatgtgatcgttcagccgacgacacaaggcaataca
tcctgcaagctagaactgtaccctctgtgtgtgaagttattgagacatcagacccctcaa
gtcaagcagaatggttggagtggtgtcaatcttggattaggcaatatatcactgagttcc
tcaggactcggtatcaacatctcagggaacagcggtaccccccaagctcccaaacgctac
caggcgtacgtggcatgcttcagtaagatgcacacgctccagcaggtccatgacttctta
tcggcgaggttaagggtcaggacggaggagatgaggttatggaacctcaaagacgagaac
aaccctgtagtccttgaagaggattccagcacgttggatcagctcggcattgccgatgag
cagagcttactgatagagatcaggaataaggatctcagctggcccgaagagatgtcatta
ttagccaagaagaaagcagataggcaatcgagtgtgcgaacagataaaggtgtgaccggt
cttagtaaccttggtaacacgtgtttcatgaattcagccgtccagtgtatcagcaacacc
cagcctctcagactatacttccaaactaagtcttacctctatgaactcaaccctacaaac
cctctggggatgaaaggtcatcttgccaagagatatggtgacctttgcaatgacctttgg
tcaggtacagcgcggagtatagcacctctcaaactcaggtggacgatagccaagtatgca
cctcgcttcagtgggttccagcaacacgactcccaggagttattagctttcttactggat
gggttacatgaagacttgaacagggtgcatgagaagccgtatgtggagctcaaggatagc
gatggaaggccggatgaagaagtcgcaacagaggcttgggagaaccacttaatcaggaac
aagtctgtgattgtggacctgttccagggccagctcaagtctcaggtccggtgtaagaca
tgcggtcacatcagcgtgaggtttgatcccttcaccttcctctccctgcctctccctatg
gaaagctccatgcatgtagagattgtggttgttcgccttgatggaagcgtacctgtcaag
tatggtttctggttctttcttcctccttccttcatattttcctttaggcatagtagtttt
ccgtccgaggcgcagaagattcgcacgatgctagggggcatcctgtacgcttacgaagta
cctcagacaagcctgtcgtcggggatctgcaaatcagcaagtcaaggatccattggatca
gaaaccaatgctagccaaactgccatgatgaattccgagtccaaccagcagcaacctctt
cctcccattgatacggtaaccaaggagaatacaggagtacacagactacctgccaacggg
gacatccccagggccgatagggtgtcaccgatcccctcgaccgattcaccggggggtggg
gagaagagaagaagattggaaaatggaaccactgccaaagatgacatggataatgacaca
ccaacaagcagtccccctgagtctatggtcagttctggtcactcaccgtccactcccagt
cagtcccgtgtccttcaagcccagcacagccggacgccaagcactgccagtggtaccagt
gcggtcaccatctcccccgtcatgccaggggcagagttcgatggcttcgtggtagccatg
catcggaaaatgattcggatggacatgtacttcctagcgtggcagaagagtcgtccgtgt
ttgtttggtctgcctctcatcctgccctgccagccctccacgaccagagaagacctgtac
aaggtggtctggactcagatctcaaggctggtcagtcctaccaaaccaactgaccataac
accggtcataacaagaaccatgctgaagactgcgacagccctcgtcagaagtacccgttt
acactgaaggcagtgctgaaggacggcttgacatgcgcctggtgcccgtggtataggttc
tgcagaggatgtgatataccttgtgaaagtgaagctctgaagacgggcttagcctacata
gccattgaatgggaccctacagctctacatctcagataccagaactcacaagaaaggttt
gtgactgagcatgagagctgcgagaacagccgacggctacagacggagcccatcaacctg
gatgattgtttacgagcgttcaccaaggaagaggagctgggggaggacgaactgtactac
tgctcaaagtgtaagcagcatcggctagcagccaagaaactggatatatggaggctacca
cctatcttgattgtacacttgaagagattccagtctgtgaatgggagatgggtgaaatcc
caaaagattgtcaaatttccgaaaagaaacttcaatgtgagtaactttgtggttccgaag
ggggacactgagcccaggataatagacgtaacgaacgatgcacctgcagagacggaagat
ctcaaagattcaagcgtactaggtccccaggctggtatcaacatcaatgccatcgagatg
agtagtgagggggcagggcaggggcgagtggacagtgggagggggagcagcgtggtcgtc
aatggagacacggatcattcagacatggaagaccccgcccaatcggaagaccccgcccca
tcggaggacggagctgtggagaagagcaaagacagacgagagagaccggctgcgcttcgt
ctggatacgtcgggcggggctctgcctctgatgaatggtgactgcaagtcagacattgtg
aatggacacggagagggagaggaggagggtggggacggggaggagggcggggccaaggat
caggatagtggttacggaacgctggagagcgggcagggtgatggttcacacagccaatca
gggtctaactcaccgagcaaacccaagttaaagaagcaggcttcattattgactccgccc
gttgatgctactggatctcatcctcttcttcatcctcaaaccaaaccagaggaagacgtg
gatgatgggcagatgtacgatctctatggagttgtgagtcatactggtatccttggtgga
ggtcattatgtttcttactctgttaatccaaacaagaagtggtactgctacaatgatagc
agtgtgaaggaggtgaaagaggagattgacatggacaacgcatacatgctcttctacgaa
tgccggtccatgtcttacgtacagtacatacccgacacgtcggggaagcacccggacatg
acgacgatagaggacgagatcgaagccgattaccgcaagttctgcgttatccaatga

DBGET integrated database retrieval system