KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579533Help
Entry
579533            CDS       T01019                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:spu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    579533
   04142 Lysosome
    579533
Exosome [BR:spu04147]
 Exosomal proteins
  Proteins found in most exosomes
   579533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1669 aa AA seqDB search
MESDKFICVREKVGDQAQVVIIDLNDSANPIRRPISADSAIMNPASKVIALKAGRTLQIF
NIEMKSKMKAHTMTEEVTFWKWINVNTIGLVTDTTVYHWGMEGDSQPIKAFDRHSSLAGC
QIINYRTDAKMQWLLLIGISAQIGKEQESVPQQNRVVGAMQLYSVERKVSQPIEGHAACF
TSFKLENNPELSTLFCFGVRGAAGGKLHIIEVGSPATGNQPFTKKAVELFFPPEAQSDFP
VAMQVSPKHNVIFLITKYGYVHLYDVETATCIYMNRISGETIFVTAAHETTAGIIGVNRK
GQVLTVSVDDENIVPYITNNLQNPDLALRIAVRNNLSGAEDLFVRKFNTLFQQGNYSEAA
KVAANAPKGILRTPQTIQRFQQVPTQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQ
QGRKQLLEKWLKEDKLECSEELGDLVKAHDPTLALSVYLRASVPNKVIQCFAETGQFQKI
VLYAKKVNFTPDYVFLLRNVMRVNPDQGAGFAQMLVQDEEPLADINMIVDVFMEQNLVQP
CTSFLLDALKNNRPAEGHLQTRLLEMNLLSAPQVADAILGNQMFTHYDRAHIAQLCEKAG
LLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECIKAMMTANIRQNLQI
CVQVATKYHEQLTTTSLIDIFETFKSYEGLFYFLGSIVNFSQDSDVHFKYIQSACKTGQI
KEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIE
IYVQKVNPSRLPVVIGGLLDVDCSEDIIKSLIMVVRGQFSTDELVEEVEKRNRLKLLLPW
LETRIHEGSTEPATHNALAKIYIDSNNNPERFLRENQFYDSRVVGKYCEKRDPHLACVAY
ERGQCDRELINVCNENSLFKSEARYLVRRRDQELWAEVLLEDNPFRRQLIDQIVQTALSE
TQDPEDISVTVKAFMTADLPNELIELLEKIVLENSVFSDHRNLQNLLILTAIKADRTRVM
EYINRLDNYDAPDIANIAIDSELFEEAFAIFRKFDVNTSAIQVLIEHIKNLDRAYEFAER
CNEPDVWSQLAAAQIKAGMVKEAIDSYIKANDPSTYLEVVEAASESGNWEDLVRYLQMAR
KKARDAYVETELIFAFAKTNRLADLEEFISGPNHAQIQQVGDRCYNEGMYEAAKLLFNNV
SNFARLASTLVHLGEYQAAVDSARKANSTRTWKEVCFSCVDGEEFRLAQMCGLHIVVHAD
ELEELINYYQDRGYFEELIQLLEAALGLERAHMGMFTELAILYSKYKPSKMREHLELFWS
RVNIPKVLRAAEQAHLWAELVFLYDKYEEFDNAIVTMMTHPTDAWRETHFKDVITKVANI
ELYYKAIQFYLDYKPMMLNDLLVVLIPRMDHTRAVGLFEKLSQLPLVKPYLRQVQSHNNK
AINDALNDLLIEEEDYQGLRASIDAFDNFDNIALAQNLEKHELIEFRRIAAYLYKRNNRW
KQAVELCKKDRLFKDAMQYACESRNIDIAEELVNWFLEQNNHECFSASLFNCYDLLRPDV
ILELSWRHDIMNFAMPYMVQVMREYLGKVDRLTESEKERKEEEQSNENQPLVYNEPTLMI
TAGPGIAPGMPAGMPAGMPPQPGMIPAGMMPGMAPGMAMAGAQPGYYGM
NT seq 5010 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggacaagttcatctgcgtgagggagaaggtaggtgaccaggcccaggtggtc
atcatcgacctcaacgactccgcaaaccccatcagaagacctatctctgcagactcagcc
atcatgaaccctgccagcaaggtcattgccctcaaagctggccgcaccctccagatcttc
aacattgagatgaagagcaagatgaaggcccacacgatgacggaggaagtcaccttctgg
aagtggatcaatgtgaacactatcggtttggtgacggataccaccgtctaccattggggc
atggagggcgactcccagcctatcaaggcatttgaccgtcactctagcttggctggatgt
cagatcatcaactacaggacggacgccaagatgcagtggctgctgctcattggtatctca
gcgcagattggaaaagaacaggaatccgttcctcagcaaaaccgtgttgtaggagcgatg
cagttgtactccgtggaacgcaaggtcagccagccgatcgagggtcacgctgcatgcttc
acgtccttcaaattagagaataacccagagctgtccactctcttctgctttggtgtccgt
ggtgctgcaggaggcaagctgcacatcattgaagttggttccccagccacaggcaatcag
ccattcaccaagaaggccgttgagctgtttttcccaccagaagcccagagtgatttccct
gtagccatgcaagtaagtcccaaacacaatgtcatcttcctcattaccaagtacggctac
gtccacctgtacgacgtagagacagcaacctgtatctacatgaaccgtatcagcggtgag
accatctttgtgaccgcggcgcatgagacgactgctggtatcatcggtgtgaacaggaaa
ggacaggttctgacagtgagtgttgatgatgagaacatcgttccctacatcaccaacaat
ctccagaacccagacctggccctgcgtatcgctgtccgtaacaacctgtctggtgccgaa
gacctctttgtacgcaagttcaacaccctgttccagcagggcaactactctgaggctgct
aaagtggctgccaatgcaccaaagggtatcctgaggacccctcagaccattcagaggttc
cagcaggttcccacccagccaggccagacctcacccctcctgcaatactttggtatcctg
ctagaccagggtcagctcaacaagtatgagtctctggagttgtgtcgtccagtcctgcag
caggggcgcaagcagctgctcgagaagtggctcaaggaagacaagcttgaatgcagcgag
gagcttggtgacctggtcaaggctcatgacccaacgttggccctctctgtctatctccgt
gccagtgtaccaaacaaggtgatccaatgctttgctgagactggccagttccagaagatt
gttctgtacgccaagaaggtgaacttcaccccagactatgtgttccttctgcgtaacgtg
atgcgtgtcaacccagaccagggagccgggttcgcccagatgctggtccaagacgaggaa
ccgctcgctgatatcaacatgatcgtggatgtgttcatggagcagaaccttgtccagccc
tgcacctcgttcctcctggatgccctgaagaacaaccgccctgccgagggtcacctgcag
acccgtctcctggagatgaacctcctctctgcccctcaggtcgctgatgctatactgggc
aaccagatgttcacccactatgaccgcgcccacattgcccagctctgtgagaaggctggt
cttctacagagggcccttgagcattacacagacctatatgacatcaagagggctgtagta
cacacccatctacttaacccagagtggctggtcaactactttggctcactgtccgttgag
gactccctggaatgcatcaaggccatgatgaccgccaacatccgccagaacctccagatc
tgtgtccaggtagccaccaagtaccatgaacagttgaccaccacatccctgatcgatatc
tttgagaccttcaagagctacgagggtctcttctacttcttgggctccattgtcaacttc
agccaggactccgatgtccacttcaagtatatccagtctgcctgcaagaccggccagatc
aaggaagtggagcgtatctgcagagagagcaactgctacgatcctgagcgtgtcaagaac
ttcctgaaggaggccaagctcaccgatcagctccctctcatcatcgtctgcgatcgcttt
gactttgtccatgatctagtgctctacctgtaccgcaacaacctgcagaagtacattgag
atctacgtgcagaaggtgaacccatcccgtctgcccgtggtcatcggtggcctgctcgat
gtcgactgctcagaggacatcatcaagagcttgatcatggtggtcaggggtcagttctcc
accgatgagctggttgaggaggtggagaagcgtaaccgcctcaagctcctcctgccctgg
ctggagacccgcatccatgagggaagcactgaaccagccacccacaacgccctggctaag
atctacatcgatagcaacaacaacccagagcgtttcctcagagaaaaccagttctacgat
agccgtgtcgtcggcaagtactgcgagaagcgcgaccctcacctggcctgtgtggcttac
gagcgagggcagtgtgaccgagagctcatcaacgtgtgcaacgagaactccctgttcaag
agcgaagcccgctacttggtgagacgacgggatcaggagctgtgggccgaggtactcctg
gaggataacccattcaggagacaactcattgaccagattgtccaaactgccctgtcggag
acccaagatccagaagatatatccgtgactgtgaaagctttcatgactgccgatctgcca
aacgaactgattgaactcctagaaaagattgtgctggagaactctgtcttcagtgatcac
aggaaccttcagaacctgttgatcctgacggctatcaaggcagaccgtacccgtgtcatg
gagtacatcaaccgcctggacaactacgatgctccagacatcgcaaacattgctatcgat
agcgaactctttgaggaagccttcgccatctttaggaaatttgatgtcaacacatctgct
attcaagtcctgatcgagcacataaagaatctagaccgggcctacgagtttgcggagagg
tgcaacgagccggacgtgtggagtcagttggctgctgcccagatcaaggctggcatggtc
aaggaggcaattgattcctacatcaaggctaacgacccctccacctacctggaggtcgta
gaagctgcttcagagtcagggaactgggaggacttggtacgctacttgcagatggctcgc
aagaaggctcgtgatgcctacgttgagactgagcttatctttgctttcgccaagacaaac
cgtctcgctgatcttgaggagttcatctcaggacctaaccatgcgcagatccaacaggtt
ggtgacaggtgttataatgaaggcatgtatgaagcagccaaactactcttcaacaatgtc
tccaactttgctcgcctggcatccacgctcgttcatctcggtgaataccaggctgctgtc
gacagcgctcgcaaggccaacagcacccgcacatggaaagaggtatgcttctcttgcgtt
gacggcgaggagttccgtctggcccagatgtgcggtctccacatcgtggtccacgccgac
gaactggaagagctcatcaactactaccaggaccggggctactttgaggaactgatccag
ctcctcgaggctgcgctgggcttggagcgggcacatatgggcatgttcaccgagttggct
atcctctactctaaatacaaaccatccaagatgagggaacatctggagctcttctggtca
cgtgtcaacattccaaaggtccttcgtgcagcagagcaagctcacctctgggccgagctg
gtgttcctctacgacaagtacgaagagtttgacaacgccatagtcaccatgatgacacac
cccacggatgcatggagagaaactcacttcaaagatgtcatcactaaggttgccaacatt
gagctgtactacaaggctatccaattctatctggactacaagcccatgatgctcaacgac
ctcctggtagtactcattcctcgcatggaccacacccgagctgtaggactctttgagaag
ctcagccaactgccactggtcaaaccttacctcagacaagtacagagtcacaacaataag
gcgataaacgacgccctgaacgatctcctgatcgaggaggaagactaccagggcctgagg
gcgtccatcgatgcctttgacaactttgacaacatcgccctggcccagaacctagagaaa
catgaactgattgaattccgtcgcattgctgcttacctctacaagcgcaacaaccgctgg
aagcaagctgtggagctctgcaagaaggataggttattcaaggatgcaatgcaatatgcc
tgtgagtcgaggaatatcgacatcgcggaggagcttgtgaactggttccttgaacagaac
aaccatgagtgcttcagtgcatcactcttcaactgctacgatctcctgcgtccagacgtg
atcctggagctctcatggaggcacgacatcatgaactttgccatgccctacatggtccag
gtcatgagggagtacttgggaaaggttgatagactgaccgaatcagagaaggagaggaaa
gaagaggagcagtcaaatgaaaaccaacccctcgtatacaatgagcctacgctcatgatc
accgccggtcccggtattgcaccaggcatgccagcagggatgccagcagggatgcctcct
caaccaggtatgataccagcaggtatgatgcctggtatggcaccgggtatggctatggcc
ggtgcacaacccggctactacggtatgtaa

DBGET integrated database retrieval system