KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579661Help
Entry
579661            CDS       T01019                                 

Gene name
usp8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:spu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    579661 (usp8)
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     579661 (usp8)
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   579661 (usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1187 aa AA seqDB search
MPGALKKTLYIGSSLEELNRKVDHNVTKGQTSKIYARSANTVLSEAEKADKSLDEERAYV
LFMKYLALWKAVKAAKDYKQNKDYVDALLGTVGCRKAIDKAEELSASLNLRYSELEEAKE
ASKKIEEEKERVKANGLKDGKTKDGEEKSVENGVPEEEKKERKRELGKDGAVNAIVLYKE
LESNPNSVLIMDVRRSDHFKDSHMTIGQCISIPAEILTPGMTAATLEKGLGEEAKVMWKQ
RTDMEFIVLVDWDQCQRADSTLAIVEAAMCKWDWGTTYKNPPLVLKGGYEDWLFKYPMYT
NNPQAKKPAEKVEETKNLLDFEYPVFDDDKPPPPALPSQQLNNVPTSHSPSEQNGNGNGG
YQNRMFYISGKPGQTGQTGQRPVVNRSVKPGTTNPDPVAPNRDETDSSRDKPKFAPAPVA
NLITNNLESKTIARTPDLAKSGPASSTTKPTSALPAVNRNLKPKIENSAANLNEKDTSDT
AAYNTNGSELGEDSSVSLKEFSLEAGKKSDIHLEELKKKEEQARNDLNKMRYDKTKAEND
KTKAENEKLKEEKLEMESNLLKLQKELAEAKARQEQRKRTPQKTSSPSHNAQSPSPMARK
QDATDSGGSSSSDAAPRTASSTSASSKKVADDSSNEPAVDRNAAQPNQNSNAASAEVKSV
TGASSREASTSSSASSSASAASPPPVTAAVVGPTLPQGWEKRWDEKSRRYFYLDHNTSKT
QWHIPGEPAPKTMADQGPSRGASTAMASPKPKGDTPSSRPSGQVTRMPLKSDSVEPSAKS
SGLKRSYSSPNIAQMVMNEGEATFNKPFPSVDRSTKPAERSPQAISQFKSTANRARQLNP
IFGNQGRALTGLRNLGNTCFMNSVVQCLSNTTPLAKYFITDDYLQDINRANPLGRGGEVA
EEFAVVVRANWSGQYRSIAPRDLRDTVTKYVPEFRKHVGHHHDSQEFLLFLLDGLHEDLN
EVKKRQYIKEEDFSKYPDHEAAGLSWRNHEKLNRSIIVSLFQGQFKSTVRCLSCNNKSVK
FEAFMYLSLPIASKSKCSLHECLQQFSKPEELTGDNATHCTHCKGNRKSEKTILIWKLPH
ILLIHLKRFYYEGMWRQKLQTNVDFPNDLTMDRYVIGPAQRNIYQLYGVSNHSGTLDGGH
YTACCRNAVNKRWYKYDDHEVYDASKSSIKSSAAYILFYSSLPLTPP
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgcctggagcattgaagaaaacactctacatcggctcctctctggaggaactcaacagg
aaggtggaccataacgttaccaagggacaaacttcaaaaatatacgccagatcagcgaac
acggttctctctgaggctgagaaggctgataaaagcctggatgaggagcgtgcgtatgtg
ctgtttatgaagtacctcgcactatggaaagctgtcaaagctgcaaaagattataagcag
aacaaggattatgttgatgctcttcttggtactgtaggatgcaggaaggctatagataaa
gcagaggaactctcagcatcattaaatttaaggtacagcgagctagaggaagcaaaggaa
gcaagtaagaaaatagaggaggagaaggagagagtgaaagcaaatggtttaaaggatgga
aaaacaaaagatggagaggagaagtcagtggagaatggagtccctgaggaggagaaaaag
gaacggaagagagaattggggaaagacggtgccgtaaatgcaatcgtgctgtacaaggag
ctggaaagcaatcccaattcggttctaatcatggacgtccgtcgatctgaccactttaaa
gactctcacatgaccattggacagtgtattagcattccagccgagattctcacacccgga
atgactgctgctacattggagaagggtttgggtgaggaagccaaggtgatgtggaaacag
agaaccgacatggaattcatcgtacttgtagactgggaccagtgccagagggcagactct
actcttgccattgttgaagctgccatgtgtaagtgggactggggtacaacatacaagaat
ccaccactggtgttgaagggtggctatgaggactggcttttcaaatatcctatgtatacc
aacaatcctcaagcaaagaagcctgcagagaaagtggaagagaccaagaacttactggac
tttgaataccctgtctttgatgatgacaagccacctcccccagccctcccttctcagcaa
ctcaacaatgtcccaacaagtcattcaccatctgaacagaatggcaatggcaatggtggc
taccagaacaggatgttctatatctctgggaagcctggccagactggccaaactggccaa
agaccagtagtcaatcgatctgtgaagccaggaacaaccaatcctgatccagtcgctcct
aacagagatgagacggattcatcaagagacaaacctaaattcgcacccgctccagtagct
aatctaatcactaataacctagagagcaagacaattgcgcggacacctgatcttgccaag
agtggacctgcaagtagtactacaaagccaacatccgcactgcctgcagtcaatcgcaac
ctgaaacccaagattgagaacagtgcagcaaacctgaatgagaaagatactagtgacact
gctgcttataataccaatggctctgaactaggggaagacagtagtgtgtctttgaaggag
ttttcgctggaggcaggcaagaagtcggatatacatttagaagagctcaagaaaaaagaa
gagcaggcaaggaatgacctgaacaagatgcgctatgacaaaactaaagcagaaaatgac
aaaactaaagcagagaatgaaaaactcaaagaagaaaagctagaaatggagagtaacctc
ttgaaacttcaaaaagaacttgcagaagccaaagcaagacaggaacagcgaaagcgaact
ccacagaagacctcatcaccaagccataatgcacaatccccgtcccccatggccagaaaa
caggatgctacagattctggaggaagcagttcaagtgacgcagccccaaggactgcaagc
tccacgtcagcatcaagcaagaaggtggctgatgactcgtctaatgagcctgctgttgat
aggaatgcagcacaacccaatcagaattcaaatgctgcttcagcagaggtgaagtctgtt
acaggagcttcttctagagaggccagcacgtcatccagtgcttcatcatcagcttctgct
gcatcaccaccaccagtgacagcagccgtagtaggtccaacattgcctcagggttgggag
aagcgatgggatgagaagagtagacgatacttttacttggatcataacactagcaaaacc
caatggcacataccaggggaaccagctcctaagaccatggcagaccaaggacctagccgt
ggtgctagtacagcgatggcttcaccaaagcccaaaggtgataccccgtcatcacgtcct
tctggtcaggtgacccgcatgcctctcaagtccgactcggtggagccttctgccaagtcc
agtggtctcaagcgatcctactcctcacccaacattgcgcagatggtgatgaatgaaggt
gaagcaaccttcaataaaccgtttccatccgtggataggagtaccaaaccagcagagaga
tcaccgcaggcaatatcccagttcaagtcgacggctaatagggcacgtcagctcaaccca
atatttggtaaccagggtcgtgcgttgaccggtctccgtaaccttggtaacacctgcttc
atgaactctgtggtacagtgtctgagtaatactacaccccttgcaaagtacttcatcaca
gatgactatctgcaggatatcaacagagcgaaccccttggggaggggtggtgaggtggca
gaagagtttgcggtggtggtccgtgcgaactggtcgggtcagtataggtcaatcgcaccc
agggatctgagagacactgtcaccaagtatgtacctgagttcagaaagcatgttggtcat
catcatgattctcaagagtttctcctattcctcctggacgggcttcatgaagacttgaat
gaggtcaaaaaacgacagtacatcaaggaagaagacttcagcaagtatcctgaccatgag
gctgctggcctctcttggcggaaccatgagaagctcaacaggtccatcatcgtgagtctg
ttccagggtcagttcaagtccacggtccggtgtctgtcctgcaacaacaaatcggtcaag
tttgaggccttcatgtacctctctctacccatagcctccaaaagcaaatgtagccttcat
gaatgtttgcagcagttctcaaagccagaggaactaacgggagacaatgccacgcactgc
actcactgtaagggaaaccgcaaatcagagaaaaccatcctcatctggaaactgccacac
atactcctcatacatctcaagagattctactatgaaggcatgtggcgtcagaagctacag
accaatgttgattttcccaatgacctcacgatggatcgatacgtgataggtccagcacag
aggaatatctatcaactctatggtgtctctaatcactctggaaccctcgatggtggacat
tacactgcatgttgtaggaatgctgtcaataagagatggtataaatacgatgatcatgaa
gtctacgatgcctcaaagagcagtataaagagttcagcggcttacattctcttctactcc
tcgttacccctcacacctccttga

DBGET integrated database retrieval system