KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579782Help
Entry
579782            CDS       T01019                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 1
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     579782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 269 aa AA seqDB search
MSCVGFLEPIIGRIGGNEPAFLDMMAYFMMFCGFLAGAVLSAGIRTPYGRYTSPKFGWGL
ESRTAWFIQELPSFAVPVLLILFCNNQYSSTLPNTILVGYYLVHYFQRTFLFSLLIRGGK
VTPLVPFVLATIFCCYNGFMQGRYLTQYAVYSQDWMKDPRFILGSLLFLTGMAINIHSDY
ILRNLRKPGETXYKIPCGGMFDYVSGANFFGEIVEWIGFSIACWSLQGLAFAFFTFCVVS
PRAWQHHVYYLEKFEDYPKSRKAVIPFIL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtgtaggtttcctagagccgattattggaagaataggaggaaatgagccggct
ttcctggacatgatggcgtattttatgatgttctgcgggtttcttgcaggagcggtattg
tcagcgggtatacgcacaccttacggccgatacaccagtccaaagttcggctggggattg
gagagccgcaccgcctggttcattcaagagctaccctcgttcgctgttccagttctcttg
attctgttttgtaacaaccagtacagctcgactctaccaaatactattcttgttggctat
tatttagtgcattatttccaaaggacttttctattttcgctgctaatacgtggagggaaa
gtgacaccgctcgtcccgtttgtgctagccaccatcttttgctgttataatggtttcatg
cagggtcgatatcttacgcagtatgctgtgtacagccaagactggatgaaggacccacga
ttcatcttaggatcacttttgttcttgactgggatggcaatcaacattcattctgactac
attctgaggaatctacgaaaacctggagagacgtgatacaaaataccatgtggtggcatg
tttgactatgtctctggagccaacttctttggtgagatagttgaatggatcgggtttagt
atagcctgctggtctctacagggtcttgcgtttgcattcttcactttctgtgtagtctca
ccaagagcgtggcaacatcatgtgtattatctagagaagtttgaggactatcccaagtcc
aggaaagcagtcataccattcatcctctga

DBGET integrated database retrieval system