KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579785Help
Entry
579785            CDS       T01019                                 

Definition
histone H2B.2, embryonic-like
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 141 aa AA seqDB search
MAPTAQRAKKGSKKAAKAPRPSGGKKRNKKRKESYAIYIYKVLKQVHPNTGISSRAMVIM
NSFVNDIFERIASESSRLAKYNTKSTITWREIQSAIRLILTGELLKHAVREGYHSFTMKR
RSELVNPFYDKNVNDEGSGGR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggctccaacagctcaaagggctaagaaaggctccaagaaagcagccaaggcccctcgg
cccagcggtggcaagaagaggaacaagaaaaggaaggagagttatgcaatctacatctac
aaagtcctcaagcaggttcatccgaataccggcatctccagtcgggccatggtcatcatg
aacagcttcgtcaacgacatcttcgagcgaattgccagcgaatcttcccgcctcgccaag
tacaacacgaagtcaaccatcacctggcgtgagattcagagcgccatccgccttattctt
accggagagttgctaaagcacgctgttcgcgaaggttatcacagtttcacgatgaaacgt
cgtagcgaattagttaatcccttttatgataaaaatgtgaatgatgaagggagtggagga
agatag

DBGET integrated database retrieval system