KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579906Help
Entry
579906            CDS       T01019                                 

Definition
(RefSeq) histone acetyltransferase type B catalytic subunit
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     579906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 415 aa AA seqDB search
MAGAVANNMDSMRSALEEFISRANDVIEMKLVRSKEDIEDSTRSFAPEFTHQIFGENETV
FGYRGLKVQLYFSAARLTPYLTYTFEEKVNPKKFDGVQADPILKPIVEKLEITPMDNLDR
FVASLDEDVGFQPMGDLLHSYSNTDEAHGATRHFEIYKCNVMTPGFKEFHSHLQTFLWWF
VDASSYIDFDDERWMYYTIFERYPHDGTKRYSTVGYSTVYRYYAYPDKIRPRISQVLILP
PFQRQGHGAQFLETMYADFRKDTEVLDITVEDPSDDFVRLRDFIDCRACAQLPSFAPENL
PKGLCDAMEKEALEKLKLNKKQVRKIYEILRLKSTDYSNTEHAKAYRLDVKKRLNIPFQK
QKADYEKLKKVLKPEELTAAEEGTSLEERHQTLEKWFQLLLEDYRKVLDRLSMSD
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgctgtagctaacaacatggatagcatgaggagtgccctggaggagtttatt
tctagagctaatgatgttatagaaatgaagctagtccgttctaaggaggacattgaagat
tctaccaggtcctttgctcctgaattcacacatcagatctttggtgaaaatgaaacggta
tttggatacagaggtctgaaagtgcagctgtacttttcagcagccaggcttacaccttac
ctaacatacacatttgaggagaaggtcaatccaaagaagtttgatggagtacaagcggac
cccattctcaagcccatcgtggagaagctggagatcacacccatggacaacctcgaccgg
tttgtcgccagcctggacgaagacgtcggcttccaaccgatgggggacctcctccactcc
tactccaacacagacgaagcccacggtgccacgagacactttgagatctacaagtgcaac
gtcatgacccctggattcaaggagttccactcgcacctgcagacgttcttgtggtggttc
gtggacgcgtcttcttacattgattttgatgatgagaggtggatgtactatacaatcttt
gaaaggtatccccacgatggaacaaagcggtactcaacagtcggttactcaacggtctac
aggtactatgcctatccagataagatcaggccaaggataagtcaagtcctgatcctccca
ccattccaaagacaaggccatggagctcaattcttagagacgatgtatgctgacttcagg
aaagacacggaagtgcttgatatcacagtggaagacccatctgatgattttgtaaggctg
agggacttcatagactgcagggcctgtgcccaacttccttccttcgcaccggagaacctc
cccaaaggattgtgtgatgccatggagaaagaagctctggagaaactcaagttgaacaag
aaacaagtgaggaagatttacgagatcctgcggctcaaatcaacagactacagcaacaca
gagcatgccaaggcatacaggctggatgtgaagaagagactcaatattccttttcaaaaa
caaaaggctgactatgagaagctgaagaaggtgctgaagcccgaggaactgacggcagca
gaagaagggaccagtctggaggagaggcatcagacccttgagaagtggttccagctcctc
ctggaggactaccgcaaggtccttgaccgcctctcgatgtccgactga

DBGET integrated database retrieval system