KEGG   Strongylocentrotus purpuratus (purple sea urchin): 579990Help
Entry
579990            CDS       T01019                                 

Definition
probable polyprenol reductase-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     579990
    1.3.1.94  polyprenol reductase
     579990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 304 aa AA seqDB search
MDPLSWTWLVFIVSFVFVLLSYSPEVYNFLPHLIKDVVVYGKLLDPRKRTGIQQYLLVPK
RWFVHFYILSFIWNGFILMNVVQCTLQGSVLPLWFSKMMSFLTSYPVSPPAVDLLTVLIA
MAVIVIHAHRRIYECLAVSVYSNSSIHVTHYITGIFFYSFIGISIMAEGPNLSLKGEPIQ
LMDLVEDLRWHHIAGLLMFVWASWHHHIAHVIFASLRKTKKDVSRHMIPQGDWFDYVSCP
HYLAETLIYTSLAVILGGHHRTWWLVLSFVFSNQTAASVKVHRWYQGKFEDYPKERKAFM
PFVF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggatcccctttcgtggacctggctcgtttttatcgtgtcatttgtatttgtgttactt
tcttactctcctgaggtatacaattttttaccacatcttataaaagatgtcgtcgtttac
ggaaagctcctagacccgaggaaacgaaccggtattcagcagtatttactggtgccaaaa
agatggtttgtccacttttatatcctttccttcatctggaatggcttcatcttaatgaat
gttgttcagtgtactttacaaggttcagtcctgcctctctggttttctaagatgatgtcc
ttcctcacaagttatcctgtatcccctccagcagttgaccttctgaccgttttaatcgcc
atggctgtaatagtgatccacgctcacagaaggatctatgagtgtcttgccgtcagtgtg
tattcaaactccagtatccatgtgactcactacatcactggtatcttcttttactctttc
attggcatcagcatcatggcagagggacccaatctcagtttaaaaggtgaacctatccaa
ctaatggatcttgtggaagacttacgctggcatcacatagcaggtttattgatgtttgtt
tgggccagttggcatcatcatatagctcatgtcatctttgccagtttgagaaaaacaaag
aaagatgtgagccgtcatatgattccacaaggagattggtttgactacgtatcctgccct
cactacctagcagaaacgctcatctatacttctttagcggtcatccttggtggtcatcat
aggacatggtggcttgtccttagttttgtgttctctaatcagactgctgcctcggtcaag
gtccatagatggtaccaaggaaagtttgaggattatcctaaagagaggaaggctttcatg
ccattcgtcttttaa

DBGET integrated database retrieval system