KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580005Help
Entry
580005            CDS       T01019                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    580005
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     580005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 567 aa AA seqDB search
MSSTDALPQFSAVEDILTQATFHLKIGKHSFDVDVSICREKLTYRSVNGAKLKGESIAFT
DIVGCRSIGGGVCQQSSTDSGDGVPRKKETNHKLKLSEKSVCLQIFAYKYNKNPKAGGVR
RRVELNFVTDEFETQKENASLVEKWRLIILALLQGVEFSSVDDLTESLIPPPPHYLVCIN
PFSGKEKAVQLFKEQAKPIFEEAGITFKEIITERRGHGTEIAMNLDLKEYNGVIIVSGDG
LFYEFINGFGQRRDREEAFKMPLGILPGGSGNALCSAVLVNRGEQVLKNMACHAAVAIVK
GKVNPKDMVQIQTQNETVLSFLSVAWGILADIDIESERFRFLGATRFQAQAVQRIMFLRK
TPGRLSFLPIKDESKYRHLWGAEDKKRDSSNGISIQESQQIETNIGAKIGDSRSSSANQN
ANASSSEEGTSNAMGEVHADDLAMPSLSDPVPPNWTVIQGDFVCVLITIVSHISNDFMSH
PGRSMDEGIIMVQYMDETTTRWKLINTFDKYMTGEYLKQDFVKARVVKAFRLEPLNTKEG
ILTVDGEQVKFGPIQGMLTPSKCHCII
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtacagatgcacttccccaattttcagctgttgaggatattcttacgcaggct
acattccatctgaaaattgggaaacattcttttgatgttgatgtctcaatatgtcgcgaa
aagcttacatatcggagcgtaaatggagccaaattgaaaggagaaagcatagcattcact
gacattgtgggatgccgaagcatcgggggaggtgtctgccagcagtcgtcgacggatagc
ggggacggtgtgcccagaaaaaaggaaaccaatcataaattgaaattaagcgagaagagt
gtatgcttgcagatttttgcatacaagtataacaaaaatcccaaagctggtggcgtgaga
cgcagagtagagctaaattttgtgacagatgagtttgaaacacaaaaggagaatgcttca
ttggtggagaaatggcgtttgattattctggctcttcttcagggagttgagttttccagt
gtagatgacttgacggagtcccttataccaccaccaccgcactacttggtatgcatcaat
ccattcagtggaaaagagaaagcagttcaactctttaaggaacaagccaagcctatattt
gaggaggccggaatcacatttaaagaaatcataacagagagaagaggacatggtactgaa
atagctatgaaccttgacctgaaggagtacaatggggtcatcattgtctcaggtgatggc
cttttttatgagttcatcaatgggtttggacaaagaagggaccgagaagaagcgtttaag
atgcctctgggaatcctcccagggggttctggaaacgcactttgttcagcagtgttggta
aacagaggggagcaagtattaaagaacatggcctgccatgctgccgtagccattgtcaag
ggcaaagtcaaccccaaggacatggtacagatccagacccaaaatgagacggtactttcc
tttctttctgtggcctggggcatcctagctgacatcgacatagagagtgagaggttccgt
ttcctaggggcaacaaggtttcaggcccaggcagtccagaggatcatgttcctccgcaag
actccaggacgcctgtcatttctacccatcaaggacgagtccaagtatcgtcacctctgg
ggagcagaggacaagaaaagggatagctcaaatggcatcagcatacaggaaagccagcag
atagaaaccaacatcggggcaaagataggggactccaggagcagcagtgccaaccagaat
gcaaacgcaagttcatccgaggaaggtacctcaaatgcaatgggtgaggtgcatgcagat
gatctggcgatgccttcgctgagcgatccggttcctccaaactggacagtcattcaagga
gattttgtttgtgtcctcataaccattgtgtcccacatatccaatgacttcatgagccat
cctggtcggtcaatggatgagggcatcatcatggtccagtatatggacgagacaacaaca
cgctggaaactgataaacaccttcgataaatacatgactggggagtaccttaaacaggac
tttgtcaaggcaagagtagtgaaggctttcaggcttgagccacttaataccaaggagggt
atcttgactgtagatggagagcaggtcaagtttggacccatacaaggcatgttgacccca
tcaaaatgtcactgtataatctaa

DBGET integrated database retrieval system