KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580070Help
Entry
580070            CDS       T01019                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    580070
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     580070
Transfer RNA biogenesis [BR:spu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    580070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 309 aa AA seqDB search
MSSAASDVPLFMQVMSASHAIASQAGIIIRDIMKAGDLGVVLKNQREDDPQTEADRKAQR
CIVSSLQTRFPGITVIGEEDLTESVTDLIELGDSEDVLHRPCPDTLKSVSLADIVVWVDP
VDGTKEYTQGFLDHVTVLIGVAVNGESVGGVIHQPYYNYQVADAKMGRTMWGVVGLGCFG
FTHKELPESQRVITTTRSHGTEAVQETIDAMCPTEILRVGGAGHKVLLCLEGTASAYIFA
SPGCKKWDTCAPEALLKAAGGLLTDVHGNRYRYEKDIKRMNTGGVIAAYRAHDFYLSKVP
QSIKDALPA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagcagcgtcagatgtgcctttgttcatgcaggtgatgtctgcatctcatgcc
atagccagtcaggcagggatcatcattagagacatcatgaaagctggagatctgggagtg
gtactcaagaatcagcgagaagatgatcctcagacagaagctgaccgtaaggctcaacgc
tgtatcgtatcatctctccagacccgcttccctggtatcaccgtcataggcgaggaggat
cttactgagagtgtaactgatctgatagagttgggagattctgaggatgttcttcatagg
ccttgtcctgatactctcaagtctgtctcactcgctgatatcgttgtgtgggtagaccct
gtagacggaaccaaagaatacacacaaggattccttgaccatgtgacagtactgatcggt
gtggccgtgaatggggagtcagtagggggcgtcatccaccagccatactacaactaccag
gtggctgatgccaagatggggcgcaccatgtggggtgtggtcggactagggtgctttggt
tttacccataaagagttaccagagtcccagagggtgatcaccaccacgaggtctcatggc
accgaggctgttcaggaaactatcgatgccatgtgtccgacagagatccttagagtgggt
ggcgctgggcataaggtgttgctctgtcttgaaggcacagccagtgcatacatctttgcc
agtcctggatgcaagaagtgggatacatgtgcaccagaagctcttcttaaagctgcagga
ggtcttttgactgatgtccatggtaaccgatatcgctatgaaaaggacatcaagcgcatg
aacaccgggggcgtcatcgccgcatatcgagctcacgacttttacctctccaaagtacca
cagtcaataaaagacgctctgccggcatga

DBGET integrated database retrieval system