KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580078Help
Entry
580078            CDS       T01019                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    580078
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     580078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 302 aa AA seqDB search
VYFKDVHPKFPDGGKMSQYLENLPIDDAIDVRGPSGLLAYDGRVFTISTPWGEISHDTRR
FRFALPSKDHILGLPTGQHIYLTTRMDGKLVVRPYTPVTSDEDRGYVDLVIKVYFKDVHP
KFPDGGKMSQYLENLPIDDAIDVRGPSGLLVYDGRGNFSIKADKKSAPKKKFARNIGMIA
GGTGITPMLQLVRQVFRDEDDTSNLWLLFANQTENDILLREELEEVKKAQPDRFHLWYTL
DRPGEGWQYSSGFVSEEMLKDHMPPPGDDTLVLMCGPPPMIDFACKPNLEKLGYTEEMRF
AY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtacttcaaggacgtccatcctaagttccctgacggaggcaagatgtcccagtatctg
gagaaccttccgatcgatgatgccatcgatgtccgtggtcctagtggcctcctcgcctat
gatggcagagtgttcaccatctccactccctggggggagatcagccatgacactcgtcgc
ttccgctttgctcttcccagcaaggatcatattctgggtcttccaacaggtcagcacatc
tacctgaccaccagaatggatggtaagcttgtcgtccgtccatacacaccggtcactagt
gatgaggataggggctacgttgatctcgtcatcaaggtgtacttcaaggacgttcatcct
aagttccctgacggaggcaagatgtcccagtatctggagaaccttccgatcgatgatgcc
atcgatgtccgtggtcctagcggcctcctcgtctatgatggcagaggtaacttcagcatc
aaggctgataagaagtctgcacccaagaagaagtttgccaggaacattggcatgatcgct
ggtggtacaggtatcactccaatgcttcagctcgttcgtcaagtcttccgagatgaggac
gacaccagtaacctatggctcctcttcgctaaccagaccgagaatgacatcttgttgcgt
gaagagcttgaggaagtgaagaaggcccaaccagacaggttccatctctggtataccctg
gaccgtcctggagaaggttggcagtacagttctgggtttgtaagcgaggagatgttgaag
gatcacatgcctccaccaggagacgataccctggtcctcatgtgtggccctccacccatg
attgacttcgcttgtaagcccaaccttgagaagctcggctacaccgaggaaatgcgcttc
gcatattaa

DBGET integrated database retrieval system