KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580504Help
Entry
580504            CDS       T01019                                 

Definition
(RefSeq) glycerol kinase
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    580504
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     580504
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   580504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 562 aa AA seqDB search
MNTKHHWLACSATLFLISYKSNLQCLFVPSFQVFSSKTSELIAHHQIELQQTFPNEGWVE
EDPKEILSTVKECINETVKKLKGLGVDPAGIKAVGITNQRETTIVWDRTTGEPLHPAVLW
LDARTATTVDQLVSKTPSQTKEHLQPLCGLPLSTYFSAVKVRWLLDNVPEVKKAVDDGRC
MFGTVDSWLTWNLTGGLNGGLHITDVTNASRTMLMNITTLQWDDELCKFFDVPKTILPEI
RSSAEIYGSLVDTALKGVPIGGILGDQHAALVGQSCFKKGMAKNTYGTGCFLIYNTGEER
VFSKHGLLTTLGYKLGKDAPTIYALEGSVAVTGAAVRWLRDNLGIIKTAAEVETLAKEVD
NNGGVYFVPAFSGLYAPYWEADARGTICGLTQFSTKAHIARAVLEAVCYQTRELLDAMDQ
DSGIPLEKLRVDGGMTQNNLLMQLQADTLNIPVVRPSMPETTALGVAMAAGHAVGVWKIE
DASAGNTDTFTPVIEEDVRESHYAKWKLAVQKSMNWEGHSYTPATKGSTCSLPSIINTQT
VTAIVTSSAVLLALAYCLKKSL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaagcatcattggctcgcatgttctgcaacccttttcttaatttcttacaaa
agtaatctgcagtgtttatttgttccatccttccaggtcttttccagtaaaacatctgaa
ttgattgctcaccatcagatagaactacagcagaccttccccaacgaagggtgggttgag
gaggaccctaaggagatcctctcgactgtcaaggaatgcatcaacgagacggtgaagaaa
ctgaaaggtcttggagtcgatccggccggtatcaaagctgtaggtatcaccaaccagaga
gagacgaccattgtatgggataggacaacgggggagcccttgcatcctgctgtcttatgg
ttagatgccaggacagctaccactgtagatcagctcgtatccaagacaccatcccagacc
aaggaacatttacaacccctatgtggactacctctatcaacgtacttcagtgctgtgaag
gtcagatggttactggacaatgttccggaggtcaagaaggctgtcgatgacgggaggtgt
atgtttggaacggttgactcctggcttacatggaacctaacaggaggattgaatggaggt
ctccacataacagacgtgaccaatgctagtcgtacaatgctcatgaacattacaacatta
caatgggacgatgaactctgcaaattctttgatgttcctaagactattcttccagagatc
cgaagctcagctgagatctatggtagcttggttgatacagccctcaagggagtgcctatt
ggagggattcttggagatcagcatgcggcattggttggacagtcttgcttcaagaaaggc
atggctaagaacacatatgggactggctgtttcttgatctacaacacgggagaggagagg
gttttctctaagcacggtctcctgacgacgcttggatataaactggggaaagatgctcca
actatctatgcactagagggatctgtggcagtaacaggcgctgctgtgagatggttaaga
gacaatttgggtatcatcaaaacagctgctgaagtagagacgcttgctaaggaggtagat
aacaatggcggtgtatactttgttcctgcattctctggtctctacgctccctactgggag
gccgatgcaagaggaactatctgtggtctaactcagttcagtaccaaggctcatatagct
agggctgttctagaagcagtctgttaccaaacaagagagttgttagatgctatggaccag
gattctggcattccgcttgagaagctgagggttgatggaggaatgactcagaataatctc
cttatgcagctacaggcagatactctcaacattcctgttgtacggccttcgatgccagag
accacagctctaggcgttgccatggctgctggccatgctgtaggagtatggaagatagag
gatgcctcagcgggtaacacagataccttcacacctgtcattgaagaagatgttcgagag
tcacactatgccaagtggaagctagctgttcagaagtctatgaattgggaggggcacagt
tacacccctgctaccaaaggttctacttgcagcctgccctctatcatcaacacccagaca
gtcactgccattgtgacatcatcagccgttctactggctcttgcctactgcctcaagaaa
tctctctaa

DBGET integrated database retrieval system