KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580504Help
Entry
580504            CDS       T01019                                 

Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:spu00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 530 aa AA seqDB search
VFSSKTSELIAHHQIELQQTFPNEGWVEEDPKEILSTVKECINETVKKLKGLGVDPAGIK
AVGITNQRETTIVWDRTTGEPLHPAVLWLDARTATTVDQLVSKTPSQTKEHLQPLCGLPL
STYFSAVKVRWLLDNVPEVKKAVDDGRCMFGTVDSWLTWNLTGGLNGGLHITDVTNASRT
MLMNITTLQWDDELCKFFDVPKTILPEIRSSAEIYGSLVDTALKGVPIGGILGDQHAALV
GQSCFKKGMAKNTYGTGCFLIYNTGEERVFSKHGLLTTLGYKLGKDAPTIYALEGSVAVT
GAAVRWLRDNLGIIKTAAEVETLAKEVDNNGGVYFVPAFSGLYAPYWEADARGTICGLTQ
FSTKAHIARAVLEAVCYQTRELLDAMDQDSGIPLEKLRVDGGMTQNNLLMQLQADTLNIP
VVRPSMPETTALGVAMAAGHAVGVWKIEDASAGNTDTFTPVIEEDVRESHYAKWKLAVQK
SMNWEGHSYTPATKGSTCSLPSIINTQTVTAIVTSSAVLLALAYCLKKSL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtcttttccagtaaaacatctgaattgattgctcaccatcagatagaactacagcagacc
ttccccaacgaagggtgggttgaggaggaccctaaggagatcctctcgactgtcaaggaa
tgcatcaacgagacggtgaagaaactgaaaggtcttggagtcgatccggccggtatcaaa
gctgtaggtatcaccaaccagagagagacgaccattgtatgggataggacaacgggggag
cccttgcatcctgctgtcttatggttagatgccaggacagctaccactgtagatcagctc
gtatccaagacaccatcccagaccaaggaacatttacaacccctatgtggactacctcta
tcaacgtacttcagtgctgtgaaggtcagatggttactggacaatgttccggaggtcaag
aaggctgtcgatgacgggaggtgtatgtttggaacggttgactcctggcttacatggaac
ctaacaggaggattgaatggaggtctccacataacagacgtgaccaatgctagtcgtaca
atgctcatgaacattacaacattacaatgggacgatgaactctgcaaattctttgatgtt
cctaagactattcttccagagatccgaagctcagctgagatctatggtagcttggttgat
acagccctcaagggagtgcctattggagggattcttggagatcagcatgcggcattggtt
ggacagtcttgcttcaagaaaggcatggctaagaacacatatgggactggctgtttcttg
atctacaacacgggagaggagagggttttctctaagcacggtctcctgacgacgcttgga
tataaactggggaaagatgctccaactatctatgcactagagggatctgtggcagtaaca
ggcgctgctgtgagatggttaagagacaatttgggtatcatcaaaacagctgctgaagta
gagacgcttgctaaggaggtagataacaatggcggtgtatactttgttcctgcattctct
ggtctctacgctccctactgggaggccgatgcaagaggaactatctgtggtctaactcag
ttcagtaccaaggctcatatagctagggctgttctagaagcagtctgttaccaaacaaga
gagttgttagatgctatggaccaggattctggcattccgcttgagaagctgagggttgat
ggaggaatgactcagaataatctccttatgcagctacaggcagatactctcaacattcct
gttgtacggccttcgatgccagagaccacagctctaggcgttgccatggctgctggccat
gctgtaggagtatggaagatagaggatgcctcagcgggtaacacagataccttcacacct
gtcattgaagaagatgttcgagagtcacactatgccaagtggaagctagctgttcagaag
tctatgaattgggaggggcacagttacacccctgctaccaaaggttctacttgcagcctg
ccctctatcatcaacacccagacagtcactgccattgtgacatcatcagccgttctactg
gctcttgcctactgcctcaagaaatctctctaa

DBGET integrated database retrieval system