KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580512Help
Entry
580512            CDS       T01019                                 

Definition
DNA repair and recombination protein RAD54B-like
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    580512
Enzymes [BR:spu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     580512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 761 aa AA seqDB search
MEEGHTLCVGGKEIEVMGSISEDDWTTGKCFQTGSSSTIGASASLAVPPSRAPRPPKPFA
NPQKTGADGSTALQTKVVQPRAAKPLYDPTHQDALVMPRPPSSHQWQNNQRNDSIVDVVV
DPHLVSKLRPHQQKGVIFLYECIMGLRQYEGCGAILADEMGLGKTLQCITLVWTLFKQGP
YGGKPIIKRVLIVTPGSLVKNWCREFRKWLGSERISVFPVSSDKKVEEFKKSPLFPVMVI
SYEMMVRYADDIRGITFDLVVCDEGHRLKNSTIKTASLLSSLAVRRRILLTGTPIQNDLQ
EFYSIVEFCNPGVLGTSGSFHRVYEEPILRSNQPSATKEEKTLGAARATELSRLTSLFVL
RRTQEINNKYLPPKVETVVFCKPSALQLRLYQHLLRSPLIRSCLSRGYASSASAGSPHLV
CIGALKKLCNDPSLLYQASRKADEEGKRRGGESWLLDHDDEEESLYKGLLPIYPPDYSEG
RPLLAHCGKLCVLSEMLRAMHADPTRRERLVLVSNYTQTLDILQALCSIEGYQFCRLDGS
TPTAKRQSIVEHFNSSYAKETIFLLSSKAGGVGLNLIGASRLLLYDIDWNPANDLQAMAR
VWRDGQKKTVHIYRLITAGTIEEKIYQRQISKQSLSGAVVDAKGQSGSVKFSLEDLRDLF
TLHKGSSCITHDMLSCDCTDTNGPSSNVKAAGDVQKGPQRPCQLGKLKRAVLKKNLSMGD
LNEWQHYLAPLPEDFQDEYLLEAKDGITFVFQNETNMVPVP
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggccatacactgtgtgtaggcggcaaggaaattgaggtaatgggaagcata
tcggaagacgactggaccacagggaagtgtttccagacagggtcatcctctaccatcggt
gcctccgcatcccttgcggttcctccttccagagcaccaagacctcccaaaccattcgct
aacccacagaagacaggggctgatggttccaccgctctacaaacaaaagtggtccaacca
agagcagcaaagcccctctatgaccccacccatcaagacgcactggtgatgccacgccca
ccatcctcccatcaatggcagaacaaccaacgaaacgattccatcgtcgacgtggtggtc
gatcctcacctggtgtccaagctcaggcctcatcaacagaagggggttatcttcctgtac
gagtgcattatgggattgaggcagtatgaaggatgtggagccattctagcagatgagatg
ggtcttggtaagacactgcaatgcataactcttgtatggactttgttcaagcaaggccct
tatggaggcaaaccaatcatcaagagagttttgattgtaacaccaggcagtctggttaag
aactggtgtcgtgagttcaggaagtggcttggttcagagagaatctctgtcttccctgtc
agtagcgacaagaaagtggaggagttcaagaagagccccttgttcccagtgatggtgatc
agctatgagatgatggtgcgttacgcggatgacatcagaggtataacctttgacctggtc
gtgtgtgacgagggacatagactgaagaacagtaccatcaagactgcatcactcctatct
agtctggctgtcaggagaagaatcttgttaacaggtacccccatacagaatgatttacaa
gagttctattccattgtggaattctgcaatcctggagttttaggtaccagtggatcattc
catcgtgtctatgaagagcctatcttgagatccaatcaacccagtgctaccaaggaggaa
aagactctaggggctgccagagctactgagctttcaaggttgacaagtctttttgtactc
agacgtactcaggagatcaacaacaaatacctcccacccaaagttgagacggtggtgttc
tgcaagccgtctgccctccagctccggctctaccagcacctcctgcgctcgcccctcatc
cggtcctgcctatccagagggtacgcctcctccgcctcggccggctctccccatctggtc
tgtataggggcactcaagaagctctgcaatgatcccagcctgctctaccaagccagcagg
aaggcggatgaggaggggaagaggagaggaggagagagctggttgctagatcatgacgat
gaggaggaatctttgtacaagggtctgctacccatctaccctcctgactactctgaaggc
agaccgctgctagcccactgtggtaagctgtgtgtactctctgagatgcttagagccatg
catgctgatccaaccaggagggagagacttgtcctggtgtccaactacactcagacacta
gatatactgcaagcattgtgtagtatcgagggttaccagttctgcagactagatggttcc
acaccgaccgccaaacgacagtccatcgtggagcacttcaacagcagctatgctaaagaa
actatcttcttgctgagctctaaagctggtggagttggtttgaacctgattggtgcctcc
aggcttctcctctatgatattgactggaaccctgctaatgaccttcaggccatggctaga
gtttggcgagatgggcagaagaagacagtgcacatctatcgactcataactgctggcacc
attgaggagaagatctaccagcgtcagatcagcaagcagagtcttagcggagctgtggtg
gatgctaagggccagagtggctctgtcaagttctctctagaagatctcagagacctgttc
acattacacaaaggcagctcctgcatcacacatgacatgcttagctgtgactgtacagat
accaatggaccttcctccaatgtgaaagcagctggagatgtacagaagggcccacagaga
ccatgccagcttgggaagctaaagcgggctgtgttaaagaaaaacttgtcaatgggtgac
ttaaatgaatggcaacactacctcgcacccctccctgaagatttccaggatgaataccta
ctggaagccaaagatgggatcacattcgtcttccaaaatgagaccaacatggtcccagta
ccatag

DBGET integrated database retrieval system