KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580712Help
Entry
580712            CDS       T01019                                 

Definition
TGF-beta receptor type-2-like
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    580712
   04068 FoxO signaling pathway
    580712
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    580712
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     580712
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   580712
Enzyme-linked receptors [BR:spu01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   580712
Cytokine receptors [BR:spu04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   580712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 595 aa AA seqDB search
MDIKINLMLLMVVPFVVTVSLGVASAFECLDCSEVPVECDAESCVPISCTTSVPCVGYCL
IATFPDMTSSSMTNGSDPSSQNINGMFACINETNPEIGGKKHCQAHPDDYSYAAEGSYSC
SCASDGCNKVLYTAEATIPEEPTVPPSSEPDATPTKTKGPPIENTDPNKTEEGRKGQMLD
REILVIVVCSVVPAVLLTIVIAVAGYIHFTRYRQPMNDELNTQTQTSNTESTSIDMTTDE
SETKRLGEYSPPDSPLHLNGNYLPITLDELIGKGRFGAVWRAHWKINNGTKERTVAVKVF
LEYDSASWNVEKELFTDHSVMMRHEHIVQFISAEVRRVSVTSPTRQYWLITKYYKNGSLH
DYLRQRSVNWIDLCKLCGSAARGLAHLHAETYGSHGLHKVPVAHRDLKSTNILVKDDGSC
AIADFGLAIRLDPQSSTDHLANSGQVGTPRYMSPEALECKVNLQDIESFKQMDTYALALI
LWEITSRCTLLKDINEYELPFSRSLGDRRASLEMMKTLVVLRRERPPITDEWLRNPGLTI
IKNTVVDCWDEDPEARLTASCVEARFQELILWHEGEPHAQSFYTSKGKRGRTTLV
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaagatcaatttgatgctcctgatggttgttccgttcgtggttacggtatcc
cttggggttgcttcggccttcgagtgtctcgactgcagcgaagtcccagtcgagtgcgac
gccgaatcctgcgttccgattagctgcacgacgtcggtgccgtgtgtcgggtattgtctg
atcgctacattccctgatatgacgtcatcatctatgaccaatggctccgatccgtcgagc
cagaacatcaatggcatgttcgcctgcatcaacgaaacaaaccctgagataggcggaaag
aaacattgtcaggcgcatcctgatgactacagttacgctgcggagggatcctactcgtgc
tcttgcgccagtgacggatgcaacaaggtactctacacggcagaggccactatacccgaa
gaacctacagtcccaccttcgagtgaacctgacgcaacccccaccaaaaccaaaggtccg
ccaattgaaaacacagatccaaataaaacagaagaaggtaggaagggacagatgttggat
cgggagattctggtcatcgtcgtctgttccgtggtgccggcagtcctcctcacgattgtg
atcgccgtcgccgggtacatccacttcactcgataccgacaacccatgaatgacgaacta
aacacccagacacagacgagcaacacagagagcacgagcattgacatgaccacggatgag
agcgagacgaaacgactcggggagtacagtcctcctgacagcccgctccatctcaatggt
aactaccttcctattacactggacgagctcattggaaaaggacgcttcggcgccgtgtgg
cgggcacactggaagattaacaatggaaccaaagagcgtaccgtcgccgtcaaggtcttc
ttagaatacgactcagcatcgtggaacgtcgagaaagagctcttcacggatcactcagtc
atgatgcgacacgagcacattgtccagttcatctcggccgaagttcgtcgtgtcagcgtg
acaagcccaactcgtcaatactggcttatcaccaagtattacaagaatggttctctgcac
gactatctgcgccagcgttctgtgaattggatcgacctctgtaagctttgtggttcggcg
gccagaggattggcacatcttcatgctgagacgtatggatcgcatgggttacacaaggta
cctgttgcgcacagagatctgaagagtaccaacatactggtgaaggacgatggctcatgc
gccattgctgacttcggattggccatccgattagatcctcaatcttcaacggatcacctg
gcaaacagtgggcaggtgggtacccctcgctacatgtctcctgaagccttagaatgcaag
gtcaatctgcaggatattgaatctttcaagcagatggacacctatgccctggccctcatc
ctctgggagatcacctcaaggtgtaccttactcaaagacataaacgaatacgagcttcca
ttcagccgcagtcttggcgatagaagggctagtctggagatgatgaagacacttgtggtc
ctgaggagagaaaggcctcccattacagacgagtggctcagaaatccaggtctcacgatc
atcaagaacacagtggtggactgctgggacgaggacccagaggcgagactgacagcgtcc
tgcgttgaggcacggttccaggaacttatcctgtggcacgagggtgagccacacgcacag
tccttctacaccagcaaggggaaaagaggcaggactactttggtctaa

DBGET integrated database retrieval system