KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580902Help
Entry
580902            CDS       T01019                                 

Definition
(RefSeq) histone acetyltransferase KAT5
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     580902
Chromosome [BR:spu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    580902
   HAT complexes
    TIP60 complex
     580902
    NuA4 complex
     580902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 464 aa AA seqDB search
MAENNVSSIKTEDLVVEGCRMPVRMDQTDEWPLGEIISRKDTDDGVLFYVHYIDYNKRLD
DWVTLDRLNLEKLQMPHKEAKTPQKEILTPNCSSRASTPERELPALAASTLAAPTPPPAP
VVVHVNGNVPKNKGNPVGRKRKLPFLETEDSLDILNVNAPRQTGSMVADKNHDDIITRIK
NIEMIVLGRHCIRPWYFSPYPIELTSKPKIYLCEFCLKYVRSVKCLERHKAKCKLRHPPG
NEIYRKNPISFFEIDGRKNKVYSQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGYH
IVGYFSKEKESTEDYNVACILTLPPFQRKGFGKLLIEFSYVLSQFEGKTGSPEKPLSDLG
LLSYRSYWSQAILECILKLPKPPDGERAQITISDVCESTSIRKEDVIYTLCNLNLINYYK
GQYVITLAKDVVDAHQKAMSKRKIRIDPKSLHWTPKDWSKRGKW
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaataatgtttcatccataaaaacagaagatttggtggttgaaggatgtcgt
atgccggtgagaatggatcaaacggatgagtggcctctcggagagatcatcagtcgcaag
gatacagatgatggagtcctgttttatgtccattacattgattacaacaagcgtcttgat
gactgggtcacactggatagactcaacttggagaagcttcagatgccacataaagaagcc
aagactccacagaaggagatcctaacaccaaactgtagctccagggcctccacccctgag
agggaactacctgcccttgccgcatccaccctcgctgcacctaccccgcccccagcacct
gttgtggtgcatgtgaatggcaatgtacccaagaacaaaggcaatcctgttggcaggaaa
agaaagctacccttccttgaaacagaggattccttggacatcttgaatgtgaatgcaccc
agacaaactggaagtatggtggcagataagaaccatgatgacatcatcacccgtatcaag
aacattgagatgattgtccttgggcgccactgtatacgaccctggtacttctcaccatac
cccattgagctgaccagtaaacctaagatctacctctgtgagttttgccttaaatatgtc
aggagtgtcaagtgcttggagaggcataaggcaaaatgcaagctgaggcatccacctgga
aatgagatctataggaagaaccccatttcattctttgaaattgatggtcggaagaacaag
gtatactcccagaacctgtgtctactagccaagctgttcctagatcataagacactgtac
tatgacacagatccattcctcttctatgtcatgactgagtttgacagcagaggttatcac
attgtgggctacttctcaaaggaaaaagaatcaacagaagactacaatgttgcatgtatt
ctcactctacctccgttccaaagaaaaggctttggaaaactacttatagaattcagttat
gtgttgtctcagttcgaaggcaagacaggatctcctgagaaacctctatctgatctagga
ctactgtcctacaggagctactggtctcaggccatcttagaatgcatcctcaagttaccc
aagccacctgatggtgagagggctcaaatcacaatcagtgacgtctgtgaatcaaccagc
atccgtaaagaggatgtgatctacaccctgtgcaacctgaacctgatcaactactacaag
ggtcagtacgtcatcaccttggccaaggatgtggtagatgcccaccagaaggccatgagt
aagcgcaaaatccgcattgaccccaagtctctgcactggacacccaaggactggtcaaag
agggggaagtggtga

DBGET integrated database retrieval system