KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580919Help
Entry
580919            CDS       T01019                                 

Definition
(RefSeq) stress-activated protein kinase JNK
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    580919
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    580919
   04068 FoxO signaling pathway
    580919
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     580919
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   580919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 417 aa AA seqDB search
MAGTKLNHHQPNHHQFNYHQLNSQFYHVTVGDTHFQILKRYKNLKSVGSGAQGLVVAAYD
VLTNQSVAIKKLSRPFQNVTHAKRAYREYILMKLCNHKNIIGLLNVFTPQRTFDDFADIY
LVMELMDASLVQVVQMDLDHERISYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKTDCSL
KILDFGLARTASTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSIGCIFGEMIRGQVMF
PGSDHIDQWNKIADLLGTPTDIFLSRLQPMVKQYVENRTKCPGYSFEMLFPDELFYQAES
STEKTKLCVAQARNLLSKMLIVDPEQRISVDEALQHPYINVWFDPGEVYGPPPIPYDHSI
DDGGDHILEEWKDGTSHPIEEEKDEREHTLEQWKGKLHYSYSESLSYPHYPLNVSKF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccaagctcaaccaccatcagcctaaccatcatcagttcaactatcatcaa
ctcaactcacagttctaccatgtcactgttggagatacacatttccagatcctcaagaga
tacaagaacctcaagagtgttggcagcggcgcccaaggtctagtcgtagctgcatatgat
gtcctcacaaaccagagtgttgctatcaagaagctaagtcgaccgttccagaatgtgacg
catgccaagcgagcgtacagagagtatatcctcatgaaattgtgcaatcataaaaatatt
attggtctcctgaatgtgttcacgccgcagcggacgtttgatgactttgcagatatttac
ctagtgatggaactaatggacgctagtctggtccaagtcgttcagatggacctggaccat
gagaggatctcctaccttctctatcagatgctatgtggcatcaaacacttacacagtgca
gggattatccacagagacttgaaacccagcaatatcgtagtaaagacagactgttcgctg
aagatcctggactttggtctcgccaggacagctagtactagcttcatgatgaccccttac
gtcgttaccaggtactacagagcaccagaggtcatcctaggcatgggctacaaggagaac
gttgatatctggtccataggctgtatatttggtgagatgatcagaggacaagtgatgttc
cccggctcagatcacattgaccaatggaacaagatcgctgacctcctagggaccccaacg
gacattttcctgagcagactccaacccatggtcaagcagtacgttgagaacaggacaaag
tgtccgggctattcctttgagatgttgttccctgatgaactcttctaccaagctgagagc
agtacggagaagaccaaactgtgtgttgcacaagccagaaatctgctctcaaaaatgctc
atcgtggaccccgaacagaggatatcagttgatgaagctcttcagcacccctacatcaac
gtatggtttgacccaggagaagtgtatggacctcctccaattccttatgaccattcaata
gacgacggcggtgatcatatattagaagaatggaaagacgggacttcacaccctatagaa
gaggagaaagacgagagggagcacacattggaacagtggaaaggtaagcttcattattca
tattcggaatcattgtcttatccacattatcccttgaatgtttcaaagttttaa

DBGET integrated database retrieval system