KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580929Help
Entry
580929            CDS       T01019                                 

Definition
uncharacterized LOC580929
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     580929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 3300 aa AA seqDB search
MMKDSDSCLANPKYTQWILEAIRKIRKQKQRPNEERICHAVRHGRGLDHADIKEQLELCV
RDGNVLKVMNKGVASYRDPEFSPGTRGGGRGRASRGTSTTKILGNLTLSTDYLRLIQSTI
KQLAEGGSTLKSVEKYIRQTYNVDTRMENDLSSKLRLAAKKGIAQAKLTKDGKLFKLPDQ
NHDKLNKLQGDNTKNNVQDERPIAEPILVCRSCHGTAECNREGKPEDLLSCAECGNSAHP
SCLKYSSALKERIRLSRWQCAECKTCAICSQGGTKELLVCDACNQGYHASCLKPPLKRIP
KGCWRCKPCRTGKMPGMGRRGPGRPGTNRLFRGKQYQAKLNKANKLKMRAMKNGVTSSFA
TKKLAASRKGQRGGGPRKHQGKQDSQGSSDGTGTTTNTTTNTTTNTNTSTTPSSTNHHPH
THHTGEGVPSSPFSRDRTPNETGLLSLESGIVSPTLTGIPPADIYDRLKPKGLIDGLSRF
FTPTNRRKSRSSSQSSAFYAIRPFRPKVKHKSESDRDAVFSAILKSRRDVLNKEKDKRLK
DKEGDTMDDTSVVEEKEEKEDKVVRTAKDDVKYIKDAKESPPSLSPSLKKLATQAASEDT
RSHSNSSSPHSQMMRTGNMQLKGLFDGLSHLYVAPASPRKRGLPPVYAVPKRSRKMSFDM
FGNDDDMFKVPAAEESPALSKASESPSVSPSPPLSTDTTPVKGQLTPKNRKLKKMKGGLS
ASASKIVKKARAMGSKKEKNGVKLTTRWAVMNKKPGKLKKKLLDDPNNEDPNDADVPAMP
KLEKGVVKTKKIIKSGEKIIKSGDSPVPSQKPKLPSGVTERDMELFRVAQEQAMLVIMPP
KSPPEGESRQTEQAAVAEATTTASTSAGPSTSTGAGAAKAQLGPGGPNAPPPVRSPCIIE
FGRYEIQTWYTSPYPQEYSRLPKLYLCEFCLKYMKSRSILVRHMTKCGWYHPPANEIYRK
GDLSVFEVDGNISKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTLNDKKGCHLVGYFS
KEKHCQQRYNVSCIMALPMYQRKGYGRFLIDFSYLLSRREGQTGTPEKPLSDLGKVSYSA
YWRSVILEYLHRNRDSKKLTIKAISRSTGMCPHDIAATLTTLRMMKRQGDKVVLRIRKKL
ISRHLTKLQQSKNKRLELDNDSLRWSPLAVSGLAVLEEEREAKREVQKMGALVSDLERER
RQGSLSPRISSPNKLTLTRDVFARDAADASPVKTKMKKKKTTCLLYPNPINAEECDCPPR
LTNQFKVHSRGMEAAFDCLPPSLTKEVHTRQKRMRKRRRKIPILQSVADEPLSKKKKSAT
NVDSDSDSGQPNLFIAEETSRPKTTPVRTGPKKKLKSPLKNKKNSKVKRGPGLGTKKLTK
SKLKLPLKGLKSKNAAKGKLAGCKGTKKGSAKGGKGKLAVKSKLGSEINGGFTSSDSDFE
PPKPPPRIGRPPKVKPALPATTGTSSSKGSTQSTGSTPGTSTTTRGRPKNGGPATPIEQR
RGWPRGLQRAKLLEDGPPAVKKRRRRRKRVPLWERKKKPKPKPKPKPPTPPPPSLQAAVP
KSATPPSRTLSVKPLPLGPVLDSDDTTSSSDEEDFARLLRLTKQVVRPKKKVPPKLVRSK
PLQLSVAIDISSTTDSDSDSDLEIRTKDPDKVAPEEKADVNTNNTTPPVTNVSPKASKDV
AATAANPQRTQSGEACVNGLDCSSSSSSNSSSDSDDNETSKATAEESTKTGDTLWNNGTT
ERISEEKSVDAKDIDEDSDAEVEVDEDEIEKGREADTELSSDDEPGGNSDDEDSDDNTEN
TIQQDAPADLSMKTNDQINSQTLSQETEHIVPSGDAFSEHASEDSDEKTENDDMLDNHST
DIRLEPEVESTVMPISKIPEESSCTRSRLSFTSSSSSSSSSEDEEEEEGKRVEELQEHSS
AEEDDHQESELDGDGPPTLAKVESPVNSPVLNRTSPFLERYDEEMHGSPPSLKETMTNED
QGEMPNDRKETLEDDDDDDEEQLRDILSPHSPAQSRDGVEDLKEHSFSSHSDHSTNAAGE
CSPQGNRFENTGEHSGVSSGEMMDFQEPKGIEPTEAEDMETAEAIESIMEMDSQGIRSPE
CMADSDDHEQTYQPNSESDFQNFSGSDTQEIRSRNSCSDMDILGLNEPPLVPPASTEVPA
IDVASVMDTPQSLDTSPMCLNTGLSSVEGSNNAENQDVVERSLMDIPNTMPTPQSMEPVP
VLETIPPLDTTQSMDTTQQMMDSVPGVIDTAPQMMTPQQPATEQQSQPVINSTPPQMDSH
VVHHVDSQRMDTNVHLETQQHIDASQAPQTDQQQPQMLGSQGQIPQQMHHPNISACQNNM
QASIGGNTHENMQSMGMPEYGRSGDMTQHSMQMGYQSCSNPVRRYRNCMEIADHHGLDPS
EMMSNTGMAGVRGMHHNLNSPHADICSTNIGPQQAQQQQQQQQQPQQQQGYSPKQSSPPG
RPGMGQPVPSISPQMNSLNSPQLGKMNSPHQINNLQSPQVCSPAMGAPMCSPAMTNNNNP
LCSPGLINTQVCSPVMNVSACSPALNNNNQVCSPVYTQTCSPARSSGPACSPAMTYPPVT
SPVISSATSCSPQMHNAPVCSPQMRSPQVCSPMGQPGAGCVMKPPLGSPTGHNGNNSNNN
VMFGPGGQQTQNKRGSTSSLAKLQQLTNDILPNNPLTVPRSPKPTANLTPPQNPTPPPVQ
TPPIQNTQVHMPRNVTPPVSQAHRQTPQRRVSMAAVDHVQQQQQQQQQQQQQQQQQHSGL
VKPGAVQQPVVDHRLPQQGAEHITHHGAEIMTQHRPDMQQQHGMDTMHGAVGMQHQVVQQ
QQQQQQQQHQQQQQQQQQQQQQQQQQQQHRQEMMQQQRQNVHSQQRQDVMTPHRHRHDSM
TSQLQDTNMSSHMQQEPSMLQHHQDNMTNNMMNPHMHNPMMAHRPESVAAHIPDARRDTS
TPHGTDAMAQHMQVQEIRRETATPHRQDPMAHNMQEAMTAHRQENMTPHLQDPMAVQRLD
TATPHREDAITPHIMDNMARQAPMTPHLQETVAQPRQDTRTPHRQGTFPQQRQETMTPRR
QEPASGTRHEAMVQHIQSGTPSLRHERRAMQHQQRAAAAAAAAAAAAEQLHQPQMPQQQT
HPNQMNPAISLQQQQQQQQQQQQQQHFGQHLPHHLQQQMGSAQTPSAAAAAAAMHSMHPT
NYKPYGHFQGHPTHNPTSPHPNMMPTVQPHCNATRPYNYLGQYQASPRHPTAPMNGYMQA
RMMSNSYHASGTPGFMEQQSMQMQMEMAMAARQQHNQPGMYPNYHRFMKPSMGGQSMMRR
NT seq 9903 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagacagtgattcttgcctggcgaaccccaagtacactcagtggatcctcgag
gccattcgcaagatcaggaagcagaagcagaggcccaatgaggagcgcatctgccatgcg
gtccggcacggccggggcctggaccacgcggacatcaaggagcagttagaactctgtgtc
cgcgacggcaatgttttgaaggtgatgaataaaggggtcgcgtcctaccgcgaccccgag
ttctctcccggcactcggggtgggggccgcggtcgtgccagccgcggcacaagcaccacc
aaaattctcgggaacctcacgctcagcacggattaccttcgcctcattcagagcaccatc
aagcagttggccgaaggcggctccacgctcaagagcgtggaaaagtatattcgccaaact
tacaatgttgacaccaggatggaaaatgacctaagcagcaagctgaggcttgctgccaaa
aagggaattgcacaagcaaaactgactaaagatggtaaattattcaaattgccagaccaa
aatcatgataaactaaacaaacttcagggagacaatacaaaaaacaatgtgcaggatgag
cggcccattgcagagcctatactggtgtgtaggtcatgtcatgggacagctgaatgcaac
agagaaggcaagccagaggatctcctctcatgtgcggagtgtggcaacagtgctcaccct
tcatgtcttaagtattcatcagctctgaaggagcgcattcggctcagtcgatggcagtgt
gccgagtgtaaaacatgtgcaatctgcagtcaagggggtaccaaggaattacttgtgtgc
gatgcctgcaatcaagggtaccacgcgagttgcctgaagccacccttgaaacgcatcccc
aaaggttgttggcggtgtaagccatgcaggacgggcaagatgcccggtatggggcggaga
ggtcctggcaggccaggcacaaacaggttgttccggggcaagcagtaccaggccaaactc
aacaaggccaacaaactcaagatgagggccatgaagaatggcgtaacatcatcgtttgcc
accaaaaagctggctgcttcgaggaaaggacaacgaggaggcggtccaaggaaacaccaa
gggaaacaggacagtcagggttcatcggatggcactggtacgaccaccaacactaccacc
aacaccaccaccaacaccaacacatccacaacaccatcatcaacaaatcaccacccccac
acacaccacaccggggagggcgtcccgtcctccccattctcaagagatagaactccaaat
gagacgggcctgctctcgctagagagcgggatcgtctctcctaccttgacagggataccc
cctgcagacatttatgataggctcaagcccaaagggcttattgatggcctcagtaggttt
ttcacgccgaccaaccgtcgcaaatcgcgcagctcgtcacagtcctccgcgttctatgcc
atccggccattccgacctaaagtgaagcacaagagcgaaagcgacagggatgccgtgttt
tcggccattttgaaatcgcggagggatgtgttaaacaaggagaaggataagagattgaaa
gataaagagggagatacgatggatgacacttctgtggttgaagagaaggaggagaaggaa
gataaagttgtacggaccgcaaaagacgatgtgaaatacatcaaagatgccaaagaatca
cctccgtcgttgtcaccgtctttgaaaaagttggctacgcaagcagcgtccgaggacacc
aggtcacattcaaactcctcctcgccgcactcccaaatgatgagaacgggtaatatgcag
ttgaaaggtttgtttgatgggctatcgcacttgtacgttgcgcccgcctcacctcgcaaa
cgtggcttacctcctgtgtacgctgtgccaaagaggtcaaggaaaatgtcatttgatatg
ttcggtaatgacgatgatatgttcaaagtacccgccgccgaggagagtccggctttgtcg
aaggcatctgaatcgccctcggtttccccgtccccaccactatctacagacaccacccca
gtcaagggacaacttacaccaaagaataggaagttgaaaaaaatgaaaggaggattatca
gccagtgcttcaaagattgtgaaaaaggctcgggcaatgggatcgaagaaagaaaagaac
ggagtgaaacttacgacaagatgggcagttatgaacaagaaaccaggaaagctcaagaaa
aagttgttggacgatccaaacaatgaagatccaaatgatgcggacgttcccgctatgccc
aagctggagaagggcgtcgtcaaaacgaagaagatcatcaaatccggtgagaagatcatc
aaatccggtgactcaccggttccatcacagaagccaaagttaccgagcggcgtgacggag
agagacatggagctgttccgggtagcccaggagcaggccatgttggtcatcatgccgcca
aagtcacctccagagggcgaatcaagacaaaccgaacaagctgctgtagctgaggcaacg
accaccgccagcaccagtgcagggccttccaccagcacgggtgcgggtgcggccaaggcc
cagcttggtccgggagggcccaacgctccgcctcccgtcagatcgccgtgcatcatcgag
tttggacggtacgagatccagacgtggtacacgtcgccgtatcctcaggaatattcccgg
cttcccaagctgtacctctgcgagttttgtctcaagtacatgaaaagcaggagcattctt
gtcaggcacatgaccaagtgtggttggtaccacccgcctgccaatgagatctaccgcaag
ggagacctctccgtcttcgaggtggatggcaacatcagtaagatctactgtcagaacctg
tgtctcctggccaagctattcctggaccataaaaccttgtactacgacgttgaaccattt
ctgttctacgtcctcaccctcaacgacaagaagggctgccatcttgttggttacttttca
aaggaaaagcactgtcaacagagatacaacgtatcctgcatcatggccttgcctatgtac
cagaggaaaggctatggaaggtttctcatcgacttcagttacttattgtccaggagagaa
gggcagacgggaacccctgagaagcctctctctgacctgggtaaggtcagttactctgct
tactggaggagtgtcatcctggagtatctgcatcggaatcgagactccaagaaactcacc
atcaaagcaatcagcaggtctacaggaatgtgtccacatgatatagcagctaccctcaca
accctacgcatgatgaaaagacagggagacaaggttgttctgaggatacgaaagaagctg
atatcacgccacctgaccaagctgcagcagagcaagaacaagaggttagaactggacaac
gactcgctccgctggtcacctctagcggtcagcggtctggcggtcttggaggaggagagg
gaggcaaagagagaggttcaaaagatgggtgccttggtgagtgacctggagcgggaaaga
cggcaagggtctctatctccgcgcatctcttctcccaacaagctcaccctcactagagac
gtcttcgcccgggatgctgccgatgctagccccgtcaaaaccaagatgaaaaagaaaaag
actacttgcttactttatcccaaccctatcaacgcggaggaatgcgattgtcctcctcga
ctaactaaccagttcaaggttcattcgcgtggcatggaggctgcatttgactgtctacct
ccgtctcttacaaaggaggtccatactaggcagaagaggatgaggaagaggagacggaag
attccaatcctgcagtcggtggccgacgaacccctgtccaagaagaagaagagcgccacc
aacgtggattcagactctgacagcggacaacccaatctcttcatcgcagaggaaaccagt
cgaccaaagaccactccagtcagaacaggccccaagaagaaactcaagtcacctctgaaa
aataagaagaattcaaaggtgaaaagaggcccggggcttggcaccaagaaactgaccaag
tccaagctgaagctacctctgaagggactgaaatccaaaaatgcagcaaaaggcaaattg
gcaggttgcaagggcaccaagaaaggatcagctaagggagggaaaggcaagcttgctgtg
aaatcaaaacttggctcggaaataaatggtggcttcaccagctcagacagtgactttgag
ccacccaaacctccacccaggattggccgaccacctaaagtaaaacctgccctcccagca
acaacgggcacctcatccagcaagggttctacgcaaagtacaggttctacccctggcacg
tccaccaccaccagagggcgtccaaaaaacggagggcccgctacccccatagagcaaagg
cgagggtggcctagggggcttcagcgggcgaaactactggaagacgggccaccagcagtc
aagaagcgcaggaggaggagaaagcgtgttccgctttgggaacggaagaagaaaccaaag
cctaaacccaaaccgaagcccccgaccccaccacctccatcactccaagcagctgtgcca
aaaagtgcaacaccaccttcaagaaccctgagtgttaagccattacccctcgggcctgtg
ctcgattcagacgataccacatcatcgtcggacgaagaagactttgccaggctccttaga
ctcaccaaacaggtggtcagaccaaagaaaaaagtgccacctaaactggtcaggagtaaa
ccactccagttgagtgtagcaatagacatcagtagcaccactgacagtgacagtgattcc
gatcttgagatcaggaccaaagacccagacaaggttgcacctgaggaaaaagcagatgta
aatacaaacaatacaacaccacctgtgacaaatgttagtccaaaggcatccaaagatgtt
gctgctactgcagcgaatccacaaagaactcagagcggtgaggcttgtgtaaacggcctt
gactgctcaagcagtagcagctccaacagcagcagtgacagtgatgacaatgagacatct
aaagctactgcagaggaatctacaaagactggtgacacactttggaataatggtactact
gagagaataagtgaagagaaatccgtggatgctaaagatattgatgaagattcagatgct
gaagtggaagtcgacgaggacgagattgagaaagggagagaagcagacacggagttaagc
agtgatgatgaaccaggtggaaacagtgatgatgaggatagcgatgataatactgaaaac
accatacaacaggacgctcctgcggaccttagcatgaaaaccaatgatcaaatcaattct
cagactctttcacaggagacagagcacatagtgccctcaggggatgcctttagtgaacat
gctagtgaagacagtgatgaaaaaacagaaaatgatgacatgcttgataatcacagtact
gatattagattggagccagaggtggaaagcactgtcatgcccatttctaaaatacctgaa
gaaagcagctgtactagatctagactctcatttacatcgtcatcttcatcttcatcatca
tctgaagatgaggaggaggaggaaggtaaaagggtggaggaactgcaggagcattcatct
gctgaagaagatgaccaccaggaaagtgagctggacggtgatggtcctcctacccttgca
aaagtggaatctcccgtgaatagtcctgtgctgaatcgtacgagtcctttcttagagcgc
tacgatgaagagatgcatggcagtcctcccagccttaaggaaaccatgacgaacgaagat
cagggagagatgccaaatgacaggaaagaaactttggaagatgatgatgatgatgatgaa
gagcagttacgtgatattctgtcaccacactctcctgctcaaagcagagatggtgtagag
gatttgaaagaacatagtttcagtagccacagtgatcatagcactaatgctgcaggagag
tgcagccctcaaggaaatcgttttgagaatactggagaacattcaggagtgagtagcgga
gagatgatggactttcaggaacctaaaggtatagaaccaacggaagcggaggatatggag
accgctgaggctattgaatccatcatggaaatggactctcagggtataagatctccagag
tgcatggctgatagtgatgatcatgagcaaacgtaccagcccaactctgaatcagatttt
caaaacttcagtggtagtgacacgcaggaaataaggtctaggaatagctgtagcgacatg
gatattttggggttgaacgagccaccccttgtgcctcctgcatcaacggaggtacctgct
atagatgttgcttcagtgatggatacaccacagtcactagacacatcacccatgtgcttg
aatactggtttgtcctccgtagaagggtccaacaatgcggaaaaccaggatgttgtagag
cgatcattgatggatattcctaacaccatgcctacccctcaatcaatggaacctgtgcct
gtattagaaaccattccacctttagataccactcaaagtatggatactactcaacagatg
atggacagtgtacctggggtcatagacaccgcaccccagatgatgacgccgcaacaaccc
gcaacagagcaacaatcacaaccagtgatcaattccaccccaccacaaatggactcacac
gtggtacatcatgtggactcgcagcgtatggatacaaacgttcaccttgaaacacagcag
catatagatgcttcgcaggcccctcagactgatcagcagcagccgcaaatgttgggttct
cagggacagatcccgcagcagatgcaccaccccaacatatccgcatgccagaacaacatg
caggcttccatcggtggcaacacccacgagaacatgcagtcaatgggcatgccagaatat
ggacgttcgggtgatatgactcaacatagcatgcagatgggttatcagtcttgcagtaac
cctgtgaggaggtacagaaactgtatggaaatagctgatcatcatggcctagatccgtca
gagatgatgtccaacactggtatggcaggggtaagaggtatgcaccataatcttaatagt
ccccacgcagatatttgcagtactaacataggcccacagcaagcacaacaacagcaacaa
caacagcaacaaccccagcagcagcaaggatacagtcctaaacaatctagcccacctggg
agacctggcatggggcagcctgtgcctagtatcagtccacaaatgaattctctcaatagt
ccacagctggggaaaatgaatagtccacaccagatcaataatctgcagagtccacaagtc
tgcagccctgcgatgggtgcgcccatgtgcagtccagcaatgaccaacaacaacaatcca
ctctgcagtcccggcctaatcaacacccaggtgtgcagcccagtcatgaacgtgtcggca
tgtagtcctgctctgaacaataacaaccaggtttgcagcccagtgtacacccaaacatgc
agtcctgctagaagcagcggtccagcctgcagccctgccatgacttatccgccagtcaca
agtccagtgattagctcagcgacctcgtgcagtccgcagatgcataatgcaccggtgtgc
agccctcagatgcgcagcccacaggtatgttctccaatgggacaacctggagctggatgt
gtcatgaagcctccgcttggttcacccactggacacaacggtaacaattccaataataat
gtcatgtttggaccaggaggccagcagacacagaacaagagaggttccacaagcagctta
gcgaaacttcagcagctgaccaatgatattttgccaaacaacccacttacagtcccaaga
tcaccaaagcctactgctaatctgacacctccgcagaaccctacaccacctccagtgcag
acacccccaatacagaacactcaagtgcatatgccaaggaatgtcactccacctgtctct
caggctcataggcagactcctcaacgtagagtgtctatggccgcagtggaccatgtacag
cagcagcagcagcagcagcaacaacagcaacaacagcagcaacagcaacattctggccta
gttaagccaggagctgtccaacagccagtggttgatcacagattaccacaacagggagca
gagcacattacccatcatggagctgaaattatgacccaacatcggcctgatatgcagcaa
cagcatggcatggacaccatgcatggtgcagttgggatgcagcatcaagtagtgcaacaa
cagcagcagcagcagcagcaacaacatcagcaacaacaacagcagcagcagcagcaacag
cagcaacaacagcaacagcagcaacacaggcaagaaatgatgcaacagcaaaggcagaat
gtacactcacaacagaggcaagatgtgatgacacctcacagacatcgccatgactccatg
acgtctcaactgcaggacaccaacatgtcaagtcatatgcagcaggagcctagtatgcta
cagcatcatcaggataacatgaccaataacatgatgaaccctcacatgcacaaccccatg
atggctcacagaccagagagtgtagcagcacacatacctgatgctagaagagacacttca
acaccgcatgggaccgatgcaatggcacagcacatgcaggtgcaggaaatcagaagggaa
acagcaacaccccatcgccaggatcccatggctcataatatgcaggaagcgatgactgca
catcgtcaggagaacatgacacctcacctgcaagacccaatggctgtccagagattagac
acggccactcctcatcgggaagatgccattacacctcatatcatggacaacatggcaagg
caggctcccatgacaccacatctccaggagaccgtcgcacaaccaaggcaagacactaga
acacctcaccgccagggtaccttccctcagcagcgccaagaaactatgacccctcgcagg
caagaaccagcatctggaacaagacatgaagcaatggtccagcacatccagagtggaaca
ccatcgttgaggcatgaacgacgtgcaatgcaacaccagcaacgtgcggctgcagcagca
gcagcagcagctgcggcggccgagcaactacatcaaccacagatgccacagcagcagaca
catcccaatcagatgaatccagccatctccctccagcagcagcagcagcaacaacagcag
cagcaacagcaacaacattttgggcaacatcttccacatcaccttcagcagcagatgggt
agtgcccagacaccatctgcagctgcagccgcagcagcaatgcacagtatgcatcctaca
aactacaagccctacggccatttccaaggacacccgacgcacaacccaacaagtcctcac
ccaaacatgatgccaaccgtccagccgcactgcaatgccacgcgtccttacaattaccta
ggccagtaccaggcgtctcctcgacaccctaccgcacccatgaacggctacatgcaggcc
aggatgatgtccaacagctaccatgccagtggtaccccaggcttcatggagcaacaaagc
atgcagatgcagatggagatggccatggcagcccgccagcaacacaaccagccgggaatg
tacccaaactaccatcgctttatgaaaccgtccatgggagggcagtctatgatgagaagg
tga

DBGET integrated database retrieval system