KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581002Help
Entry
581002            CDS       T01019                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:spu00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 252 aa AA seqDB search
MENGGPQVPQLTWAQYLYSQYLNFFYIPDGGVLKRLCDRWYGRLTDRIYQYVTEHAQRGD
PDSIIKALDRFNREQQWTFCLGDEKGHIVRKIVQKTKPKTCLELGTFIGYSAINAARELP
EGSRYLCVEPDETRAATARKLIEFAGLQDVVQVIKGFSTKVIPNLKDEFDIASFDYVFID
HVKSLYKPDLILLEEHQLLKAGTVVVADNIVIPGSPAYIEYVRNSPKYESEYFASVLAYT
NLPDGIEKSTFV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggagaatggagggccgcaagtgccacaacttacatgggctcaatatctatacagccag
tatttgaacttcttctatattccggatggaggggtcttgaagcgattgtgtgaccgatgg
tatggtcggctgaccgatcggatctatcaatacgtcactgagcatgcgcagaggggagat
ccagacagtatcataaaggcgttggatcgtttcaaccgtgaacagcagtggacattctgt
ctcggtgacgaaaaaggacacatcgtgagaaagatcgtgcagaaaacgaaaccgaagacg
tgtctggagctcggcactttcatcggctactcggctatcaatgccgctcgggaacttccg
gaaggatcgcgctacctctgtgtggagcctgacgaaactcgggctgctactgcaagaaag
ttgatcgaatttgcaggattacaagatgtggtccaagtcatcaagggtttttccactaaa
gtcattccaaatctcaaagacgagttcgacatcgccagttttgattacgtgttcatcgat
cacgtaaaatctttgtacaaacccgatctgatcctcctcgaagagcaccagcttttgaaa
gctggaaccgtcgtcgttgcggacaacatcgtcataccagggtctccggcgtatatcgaa
tacgtccgaaattcaccgaagtacgaatcggaatacttcgcgagtgtgttagcgtatact
aatctaccggatggaattgaaaaatcaacctttgtttga

DBGET integrated database retrieval system