KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581116Help
Entry
581116            CDS       T01019                                 

Definition
cytochrome P450 3A56-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    581116
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    581116
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     581116
Cytochrome P450 [BR:spu00199]
 Cytochrome P450, animal type
  CYP3 family
   581116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 530 aa AA seqDB search
MAFTILGFTVSWPLVGTLVAIIVGYEIWHMTYFKRKGIKGPSPYPVVGNSLDLFQGIHWT
TQDYVKKYGNVFGMFMFSSPVFFISDLEMVKDITVKSFSKFMNHKTFVLKSRPFDKALTG
LKDQHWKDVRNVITPTFSAVKMKQLSVLLNESSDTLVKNFGAIQEKDGKVKVFGLFEAFT
MDGIAKCAFGIQVDSQNDPSDPFVTNAKDLMKNRFSLSTMIAVTFPRIGKIMDYYGVSTM
SPKISSFFISVVDQAIAARKESGGSKMKDFLQLMLNAAQENKSEKEMIEEKPQDEKVEGD
LHALIEDQGNKSYFDLKKSKKTTLTKDEIYGQAIIFFLAGYETINTTLGFLTYSLATNPE
VQDKLIEEIDNETPTREDVGYNSIAKMSYLDNVVCEILRLYPAGVIVERQCNETHVCNGL
TIPKDSQVMFPVFAIHRDPAIWPDPEKFDPERFTKENREGRHPLAWMPFGAGPRNCIGMR
FALMEIKMATVRLLQKYRFETCPETQIPPKFAKMSLKPDDDLYLRVVERS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcactattctggggtttaccgtttcatggcctttggttggtacattagtagcc
atcattgttgggtatgaaatttggcatatgacatatttcaaacggaaaggaatcaagggg
ccaagtccttatcctgttgtgggcaactcgcttgatttgtttcaaggaattcattggacg
actcaagactatgtcaaaaagtatggaaatgtctttggcatgttcatgttttcatcgcct
gtgttcttcataagtgaccttgaaatggtgaaggatatcacagtcaagagtttcagcaaa
ttcatgaaccacaagacatttgtgttgaagtctcggccatttgacaaggcattaacaggc
ttaaaagatcagcactggaaggatgtgagaaatgtcattacaccaacctttagcgcagtc
aagatgaaacagctgtcggtattactcaatgaatccagtgacactttggtaaaaaacttt
ggagcgattcaggagaaggacggcaaggtgaaagtatttggtttatttgaagccttcaca
atggatggaattgccaagtgtgcatttggaatacaagtagattcacagaacgaccccagt
gatccgtttgtcaccaatgctaaggacttgatgaagaataggttctctttgagtactatg
attgctgtaacattccctagaattggcaaaataatggattactatggagtcagcacaatg
tcacctaaaatttcgagctttttcatatctgtggttgatcaagctattgctgctcgcaag
gagagtggaggctcaaagatgaaagacttccttcagctcatgttgaatgcagcgcaggag
aacaaatcagagaaggagatgatagaagaaaaaccgcaggacgagaaagtagaaggtgat
cttcatgctttgattgaagaccagggcaacaaaagctactttgatttgaagaagagtaag
aagacaactctgacaaaggatgagatatacggacaggctataatcttctttttggctggg
tatgaaaccatcaacacaacgctcggtttcctgacctattccctggctactaatcctgag
gttcaagacaaactcattgaagaaattgataacgaaaccccaactagagaggacgttggc
tataactccattgcaaagatgtcctatctggacaacgttgtttgtgagattcttcggctc
tatcctgcaggcgttatagttgaacgacagtgtaatgaaacccatgtctgcaatggcctc
accatccctaaagatagtcaagtcatgttccctgtctttgccatccatcgtgaccctgca
atctggcccgatccagagaagtttgacccagaaaggttcactaaagagaatcgggagggg
cgccaccccttggcctggatgccattcggtgctggtcctaggaactgcatcgggatgagg
tttgctctgatggagatcaagatggccaccgttcgtcttctccagaagtaccgatttgag
acctgcccagagactcagatccccccgaaatttgccaaaatgagcctcaaacccgacgat
gatttgtatcttcgtgttgtggagagaagctag

DBGET integrated database retrieval system