KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581116Help
Entry
581116            CDS       T01019                                 

Definition
(RefSeq) cytochrome P450 3A56
  KO
K07424  cytochrome P450 family 3 subfamily A [EC:1.14.14.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00591  Linoleic acid metabolism
spu00830  Retinol metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    581116
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    581116
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     581116
Cytochrome P450 [BR:spu00199]
 Cytochrome P450, animal type
  CYP3 family
   581116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF1796
Motif
Other DBs
NCBI-GeneID: 581116
NCBI-ProteinID: XP_786226
Position
Un
AA seq 530 aa AA seqDB search
MAFTILGFTVSWPLVGTLVAIIVGYEIWHMTYFKRKGIKGPSPYPVVGNSLDLFQGIHWT
TQDYVKKYGNVFGMFMFSSPVFFISDLEMVKDITVKSFSKFMNHKTFVLKSRPFDKALTG
LKDQHWKDVRNVITPTFSAVKMKQLSVLLNESSDTLVKNFGAIQEKDGKVKVFGLFEAFT
MDGIAKCAFGIQVDSQNDPSDPFVTNAKDLMKNRFSLSTMIAVTFPRIGKIMDYYGVSTM
SPKISSFFISVVDQAIAARKESGGSKMKDFLQLMLNAAQENKSEKEMIEEKPQDEKVEGD
LHALIEDQGNKSYFDLKKSKKTTLTKDEIYGQAIIFFLAGYETINTTLGFLTYSLATNPE
VQDKLIEEIDNETPTREDVGYNSIAKMSYLDNVVCEILRLYPAGVIVERQCNETHVCNGL
TIPKDSQVMFPVFAIHRDPAIWPDPEKFDPERFTKENREGRHPLAWMPFGAGPRNCIGMR
FALMEIKMATVRLLQKYRFETCPETQIPPKFAKMSLKPDDDLYLRVVERS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcactattctggggtttaccgtttcatggcctttggttggtacattagtagcc
atcattgttgggtatgaaatttggcatatgacatatttcaaacggaaaggaatcaagggg
ccaagtccttatcctgttgtgggcaactcgcttgatttgtttcaaggaattcattggacg
actcaagactatgtcaaaaagtatggaaatgtctttggcatgttcatgttttcatcgcct
gtgttcttcataagtgaccttgaaatggtgaaggatatcacagtcaagagtttcagcaaa
ttcatgaaccacaagacatttgtgttgaagtctcggccatttgacaaggcattaacaggc
ttaaaagatcagcactggaaggatgtgagaaatgtcattacaccaacctttagcgcagtc
aagatgaaacagctgtcggtattactcaatgaatccagtgacactttggtaaaaaacttt
ggagcgattcaggagaaggacggcaaggtgaaagtatttggtttatttgaagccttcaca
atggatggaattgccaagtgtgcatttggaatacaagtagattcacagaacgaccccagt
gatccgtttgtcaccaatgctaaggacttgatgaagaataggttctctttgagtactatg
attgctgtaacattccctagaattggcaaaataatggattactatggagtcagcacaatg
tcacctaaaatttcgagctttttcatatctgtggttgatcaagctattgctgctcgcaag
gagagtggaggctcaaagatgaaagacttccttcagctcatgttgaatgcagcgcaggag
aacaaatcagagaaggagatgatagaagaaaaaccgcaggacgagaaagtagaaggtgat
cttcatgctttgattgaagaccagggcaacaaaagctactttgatttgaagaagagtaag
aagacaactctgacaaaggatgagatatacggacaggctataatcttctttttggctggg
tatgaaaccatcaacacaacgctcggtttcctgacctattccctggctactaatcctgag
gttcaagacaaactcattgaagaaattgataacgaaaccccaactagagaggacgttggc
tataactccattgcaaagatgtcctatctggacaacgttgtttgtgagattcttcggctc
tatcctgcaggcgttatagttgaacgacagtgtaatgaaacccatgtctgcaatggcctc
accatccctaaagatagtcaagtcatgttccctgtctttgccatccatcgtgaccctgca
atctggcccgatccagagaagtttgacccagaaaggttcactaaagagaatcgggagggg
cgccaccccttggcctggatgccattcggtgctggtcctaggaactgcatcgggatgagg
tttgctctgatggagatcaagatggccaccgttcgtcttctccagaagtaccgatttgag
acctgcccagagactcagatccccccgaaatttgccaaaatgagcctcaaacccgacgat
gatttgtatcttcgtgttgtggagagaagctag

DBGET integrated database retrieval system