KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581224Help
Entry
581224            CDS       T01019                                 

Gene name
dyrk1a
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     581224 (dyrk1a)
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   581224 (dyrk1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 752 aa AA seqDB search
MSVHCSSTQLNGQPAATHPASGSQETPTGPNVAHREPILQQQAEEMAAMQSRIPHTFRDA
THAPLRKLSIDLIKTYKHINEVYYAKKKRRALPAQGDDTSHKKEKRLYNDGYDDDNYDYI
IKNGEKWNDRYEIDSLIGKGSFGQVAKAYDHQEQEYVAIKIIKNKKPFLNQAQIEVRLLE
LMNKHDADSKYYIVKLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQ
MCTALLFLATPELNIIHCDLKPENILLCNPKRSAIKIIDFGSSCQLGQRIYQYIQSRFYR
SPEVLLGISYDMAIDMWSLGCILVEMHTGEPLFSGSNELDQMNKIIEVLGMPPNHIIEQA
PKAHKYFIKTEKTWVLKRSRDGKKYKSPRTRKLQDILGVELGGPGGRRAGEPGHTVSDPH
KFKDPILRMLEYDPASRIKPYYALQHSFFKRTADGSTNTSNSTSASPAMDQAGSPPAEHS
SGSSSGGATGGSNNGSGTGGRAQSDPTHQNSTSNHALGHQHPGSSAGAMDYESMSSHSSL
TSGMSSGDVAFASSSSSAHGHSSSHTYPHPHSHSRKHHHHHSSHGHSLPSPAAPASNVNL
SQTVLQAPIVTMGIPTIPVTMGMPHVHQAGIVTTPGYVYSSHSSLENTQSSSLSSGSLNM
PMGAYAIPTHHHPSSTTQQTLVNNPHLHGTTTGTGGIALTSNVSGATSVPYAFALPVQSA
VSTGLVNSQTTRQADDSPMVGVCVQQSPVASH
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgcactgctccagtacccaactcaacggacagccagcagctactcatccagcc
tcaggctcacaggagacccctaccggccccaacgtggcgcatcgtgagcctatcttgcag
cagcaagcagaggagatggcagcgatgcagagtcgtatccctcacaccttcagggatgcg
acccacgccccccttaggaagctgagcatcgaccttatcaagacctacaaacacatcaac
gaggtatactatgccaagaaaaagaggagagcgttaccagcgcaaggggacgacaccagt
cacaagaaggagaaacgcctctacaacgacggttacgacgacgacaactacgactacatc
atcaagaacggtgagaagtggaacgaccgctacgagatcgactctctcatcggcaaaggc
tcctttggacaggtggcgaaagcatacgaccaccaggagcaagaatatgttgcaataaag
atcatcaagaacaagaaacctttcctcaaccaagcccagattgaggtccgactcctagag
ctcatgaataaacatgatgccgacagcaagtattatatagttaaactgaagcggcacttc
atgttccgcaaccatctctgtctggtcttcgagctgctctcctacaacctctacgacctc
ctccgcaacaccaacttccggggcgtgtccctcaacctgacgcgcaagttcgcccagcag
atgtgtaccgccctcttgttcctggcgacgcccgaactcaacatcatccactgcgacctg
aagccagagaacatcctactgtgcaatcccaagagaagcgctatcaagatcatcgacttt
ggtagctcctgtcagctcggacagaggatataccaatacatccagagcaggttttacagg
tcgcctgaagtgttactaggtatatcatacgacatggctattgacatgtggagtttggga
tgtatacttgtagagatgcacacgggcgaacccctcttcagtggctctaatgagttggat
cagatgaacaagatcattgaagttttaggcatgccaccgaaccacatcatagagcaggct
ccaaaggctcacaaatacttcatcaagacggagaaaacgtgggtactcaaaaggagtcga
gatggaaagaaatacaaaagtccacgaacccgaaagcttcaagatatcttaggcgtggag
cttggcgggccgggcggtaggagagcaggtgaaccgggtcatactgtctcagacccccac
aaattcaaggatcccatactaaggatgttggagtatgatcccgcctctaggataaagccc
tactatgccctccagcactccttcttcaagagaacagccgatggcagcaccaatacgtcc
aatagcacctcggctagtccagccatggaccaggccggtagtccacctgcagaacactca
tcgggttccagctcaggaggagctacagggggctctaacaacggttctggaaccggtgga
cgggcgcagtccgaccccacccatcagaacagcacttcaaatcacgccctgggacaccaa
caccccggcagctcggcgggggcaatggactacgagtcaatgtcgtcgcactccagtctg
acgtcggggatgtcgagcggggacgtcgcgtttgcgtcatcgtcaagcagtgctcatgga
cactcgagttcgcatacgtacccgcatccccactcccacagtcgcaagcaccaccaccat
cactcatcgcacggacacagcctcccatcgccggcggctccagccagtaacgtgaattta
tctcaaacagtgttacaagctcccatagtgacaatgggtatcccaactataccagtaacg
atggggatgcctcacgtgcatcaagccggtatcgtgacgacgcccggttacgtgtattcc
tcgcacagttcgctggagaacacccaaagcagctcgttaagtagtggttcgttaaatatg
cccatgggcgcttatgcaataccgacgcaccaccacccgtcgtcgaccacgcaacaaacg
cttgtaaacaatccccatttacatgggacgacgacggggacggggggtatcgcgttgacg
agtaacgtgagcggggcgaccagcgtcccgtacgcgtttgcgttaccggtgcagtcagcc
gtgagtacggggcttgtgaactctcaaacgacgagacaagcggacgattcaccgatggtt
ggtgtgtgtgttcaacagagcccagtggcatcacattga

DBGET integrated database retrieval system