KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581429Help
Entry
581429            CDS       T01019                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:spu00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 350 aa AA seqDB search
IAGQDALAQVLYDKVRVLCWIMTGPQNINTKAVHIFATWGKRCNKVIFISSEPSDKVPIV
KVATKEGRDFLWQKTRGAFQHIYDNFLDDYDWFLKADDDTFVIVENLRYFLSSYTPDTSI
YFGHKFKRYVKQGYMSGGGGYVTSRTGVKNLVEIAFKDPSKCWGMDKKGGAEDVEIGKCF
ENSGVVAGDSRDSLERNRFHPFQPEAHLDPKGLPDAFWYWDYIYYPRNEGFEGCCSDYSI
TFHYIPPAALYNLEYLVYHLRPFGVGTYPCPADVPKEILQEARSRQQSQEQPHDDQENKQ
VEQGKEQLSQEKQREEAQEKQESQPKQEKEANVDNERTDLEKAKETEQKP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
attgcaggtcaggacgcccttgcacaagtcctttatgacaaggtacgtgttttgtgctgg
ataatgactggtcctcaaaacattaatacaaaggccgttcatatctttgccacgtggggg
aagcggtgcaacaaggtcatattcatctcttctgaaccatcggacaaggtccccatcgtg
aaggtagcaactaaagaagggcgggacttcctctggcagaagacccgaggagccttccag
cacatctacgacaacttcctggacgactatgactggttcctgaaagcagacgatgacaca
tttgtcatcgtggaaaacctacgctacttcctgtcatcgtacacccccgatacgtcgatt
tactttggccacaagttcaagcgctacgtcaagcagggttacatgagcggagggggcggt
tacgtgaccagcaggaccggtgttaagaacctggtggagattgcctttaaggatccttcc
aaatgttggggaatggacaagaagggaggtgcagaagatgtggagattggcaagtgcttt
gaaaattctggtgttgttgctggggattcaagagattccttggaacgaaatcgttttcat
ccgttccaacctgaagcccatcttgatcctaaaggcctcccggatgctttttggtactgg
gattatatctattatccacgtaatgagggttttgaaggatgctgttcagattactctata
accttccactacattccacctgccgctctgtacaacctggaataccttgtttatcatctg
cgtccctttggtgtcggaacgtacccatgtccagccgatgtacccaaggagattctccaa
gaggcacgttccaggcagcagtcacaagaacagcctcatgatgatcaggaaaataaacaa
gtggagcaagggaaagaacagttaagccaagagaaacaacgggaagaggctcaggagaaa
caagagagccaaccaaaacaagaaaaggaagcaaacgttgataatgaaaggacggacctt
gaaaaagcaaaggaaacggaacaaaaacct

DBGET integrated database retrieval system