KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581429Help
Entry
581429            CDS       T01019                                 

Definition
(RefSeq) glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
  KO
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    581429
Enzymes [BR:spu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     581429
Glycosyltransferases [BR:spu01003]
 Glycan extension
  Type 3 chain
   581429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 467 aa AA seqDB search
MAAVKGNTRGFIWNFCFGLFFGCCITYLTVKFSRLNEFRSSSHMQKFDSDSNNGAGEALR
QPDGHVIVDDSNRVLESELKHFQDSHHHNFVGQDALAQVLYDKVRVLCWIMTGPQNINTK
AVHIFATWGKRCNKVIFISSEPSDKVPIVKVATKEGRDFLWQKTRGAFQHIYDNFLDDYD
WFLKADDDTFVIVENLRYFLSSYTPDTSIYFGHKFKRYVKQGYMSGGGGYVTSRTGVKNL
VEIAFKDPSKCWGMDKKGGAEDVEIGKCFENSGVVAGDSRDSLERNRFHPFQPEAHLDPK
GLPDAFWYWDYIYYPRNEGFEGCCSDYSITFHYIPPAALYNLEYLVYHLRPFGVGTYPCP
ADVPKEILQEARSRQQSQEQPHDDQENKQVEQGKEQLSQEKQREEAQEKQESQPKQEKEA
NVDNERTDLEKAKETEQKPVEIEKEIVDVLKNETKKSEIEDKKDSVR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtcaaagggaatacgaggggattcatatggaatttctgctttggattattc
ttcggatgttgtataacttacctcacagtgaaattttcaagactgaacgagtttagatct
tcttctcatatgcaaaagtttgattcagactcaaacaacggggccggggaagcgctgcgg
cagcccgatggacatgttattgttgacgactcgaaccgagtgttagaaagcgaactgaaa
cattttcaagattctcaccatcataattttgtgggtcaggacgcccttgcacaagtcctt
tatgacaaggtacgtgttttgtgctggataatgactggtcctcaaaacattaatacaaag
gccgttcatatctttgccacgtgggggaagcggtgcaacaaggtcatattcatctcttct
gaaccatcggacaaggtccccatcgtgaaggtagcaactaaagaagggcgggacttcctc
tggcagaagacccgaggagccttccagcacatctacgacaacttcctggacgactatgac
tggttcctgaaagcagacgatgacacatttgtcatcgtggaaaacctacgctacttcctg
tcatcgtacacccccgatacgtcgatttactttggccacaagttcaagcgctacgtcaag
cagggttacatgagcggagggggcggttacgtgaccagcaggaccggtgttaagaacctg
gtggagattgcctttaaggatccttccaaatgttggggaatggacaagaagggaggtgca
gaagatgtggagattggcaagtgctttgaaaattctggtgttgttgctggggattcaaga
gattccttggaacgaaatcgttttcatccgttccaacctgaagcccatcttgatcctaaa
ggcctcccggatgctttttggtactgggattatatctattatccacgtaatgagggtttt
gaaggatgctgttcagattactctataaccttccactacattccacctgccgctctgtac
aacctggaataccttgtttatcatctgcgtccctttggtgtcggaacgtacccatgtcca
gccgatgtacccaaggagattctccaagaggcacgttccaggcagcagtcacaagaacag
cctcatgatgatcaggaaaataaacaagtggagcaagggaaagaacagttaagccaagag
aaacaacgggaagaggctcaggagaaacaagagagccaaccaaaacaagaaaaggaagca
aacgttgataatgaaaggacggaccttgaaaaagcaaaggaaacggaacaaaaacctgta
gaaatagaaaaagaaattgtagatgtgttaaaaaatgaaacaaagaaaagtgaaatagaa
gataaaaaggactctgttaggtga

DBGET integrated database retrieval system