KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581433Help
Entry
581433            CDS       T01019                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     581433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 296 aa AA seqDB search
MPSKRKHIPISLLLIFLAQSSILILIFATCIIRAEYEIEEACDSGEFEADGTCKPMGAAG
ARYIHRAEMAWRSSGESHEELITRLKENGIIKNDLVLKAMRGVDRKHYSSNSPYADSPQS
IGYAVTISAPHMHAHALELLKDHLSEGKAALDVGSGSGYLTSCMAIMVGSSGKVVGIDHI
KELVDKSRKNIEKDNPDLLTSGRIQLIVGDGRQGYPAGAPYDAIHVGAAAPTLPQALIEQ
LKPGGRLIIPVGPQGAAQNLEQYDKTPEGQVTKKTLMGVVYVPLTGKEQQWPGKMK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtaagagaaaacatattccaatttctctattacttatttttctggctcagtcc
tcaattttaattttaattttcgccacatgcataatcagagccgaatacgagatcgaggaa
gcctgcgacagcggagagtttgaggcagacggaacgtgtaaacctatgggggccgcaggg
gcgcggtatattcatcgtgcagagatggcgtggagatcaagcggagaatctcacgaagag
ctcattacgagactaaaagaaaatggaatcatcaagaatgatttagtcttgaaagcaatg
cgaggtgttgatcgcaaacattacagcagtaatagtccatatgctgactctccacagagt
attggatatgctgtaactataagcgcacctcatatgcatgcacatgcccttgaacttctc
aaagatcatcttagtgaaggcaaagcagcactggatgttggatcaggaagtggctatttg
acatcctgtatggcaatcatggtaggatccagcgggaaggtagtaggaatagaccacatc
aaagaactggtagataaatctaggaagaatatagagaaagataatcctgatttactgaca
tcgggcagaatacagctaatagttggcgatggtaggcaaggatatccagctggtgcccca
tatgatgctatccatgttggtgctgcagctccaacattaccacaggcactcatcgagcag
ctgaagcctggtggtcgtctcatcatccccgtaggaccacagggtgcggctcagaatcta
gagcagtacgacaagacaccagaaggacaggtcactaagaagaccctcatgggcgtggtc
tatgtaccccttaccggtaaagaacagcagtggcctggcaagatgaagtaa

DBGET integrated database retrieval system