KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581745Help
Entry
581745            CDS       T01019                                 

Definition
(RefSeq) cell division cycle protein 27 homolog
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    581745
Protein phosphatases and associated proteins [BR:spu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     581745
Ubiquitin system [BR:spu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     581745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 804 aa AA seqDB search
MVIQEPVQAAIWQCLNHYAYQDATFLAERLYAEVGSDEGLFLLATCYYRSGQPMSAYTLL
QTKGCPTPDCRFLMARCCLDLEKYESLLCETERISKSIEAHKLAMKHNPFLWSSFEAICD
LGEKVDPEKTFHFASTPTVTTTPSQQDSYPILDTENMGGPGHLNTSAPDVTPVPSETPQD
QLITQLSGIRPLPLTTPDFNSDPGVTPDTMITPFTVPSAPLSSRQSQARIGRMHLTSPLT
SPYSPLTPRYLPLDTPSPTPGNPTSFTGDGNLADAKAPIRRGTTRRGPQGIKPPVFSQSG
NSSNTKDPALTSLHQSPAPAGSPVQLLFPSAHGVRRSSRLFSNANSVKENTSATTKTTTN
RTKTGVSKVQKGKTRARTTRSSTITKPPDLDDITKLENQKSNELNKANNAVANLQLHIAD
MQKSSAEGLLRLLRDVGKAYQALSRYDLKKAVELFKSLPPQHYNTAWVLCQVGKALFEMA
QYHKAEAIFAEVRRLEPHHLGYMEIYSTTLWHLQKETALSALAQDLTDLNPESPQAWCAA
GNCFSLQKEHDSAIKFFQRAIQVDPKFAYAYTLLGHEYVATEELDRAMACFRNAIRISPR
HYNAWYGTGMIYYKQEKFALAEMHYCKALAINPQSSVLLVHISVVQHALHKSDQALATLA
KAVRLDANNPLCRFHRASILFATEKYQDALKELEEMKQMTPSESLVYFLIGKVYKKLGQT
HQALANFSWALDLDPKGANSQIKEALDKHYLPEDDEPAVPALAQADTPSQGGIEDSDAAG
DISRESLLDGEDMQLQANESDESL
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggtcattcaagagcccgtacaggcggccatctggcagtgcttgaaccactatgcttac
caagatgccaccttcctggcagagcggctctatgctgaagttgggtctgatgaggggctg
ttcctacttgccacatgttactaccgatcaggccagccaatgagtgcctacaccttgcta
caaaccaaaggctgtcccactccggattgcaggttcctaatggccagatgctgcctggat
cttgaaaagtatgaatctttattatgtgaaacggaaaggatatcaaaatcgattgaggca
cacaagcttgccatgaagcacaatcccttcctctggagttcctttgaagccatctgtgat
ctaggtgagaaggtcgatcccgagaagacgtttcactttgcttccacgccaactgtcacc
accacgcccagtcagcaagactcctaccctatcctagacacagagaacatgggcgggcct
ggccacctcaacacttctgcacctgacgtaacaccagtaccatcagaaacacctcaggac
caactgataacccaactctctggtatcagacctctaccgctgaccacacccgatttcaac
agtgacccgggcgttacccccgacaccatgattacaccctttaccgtgcccagtgcgccc
ctgtcttcaaggcaatcccaagccaggataggcagaatgcacctcacctcgcccttaacg
tcaccctatagtcctctaacgccgaggtacttacctctagacacaccgagccctactcct
ggcaatccaacatcatttacaggagacggcaatctagctgatgcaaaggcacctatcaga
agaggcacaacaaggagaggcccacagggtatcaagccgcccgtattcagccaatcaggg
aacagcagcaacaccaaagaccccgccctcacctcattacaccaaagccccgcccctgct
ggatctccagtacaactactctttccatcagctcatggggtgagaaggagttcccgtctc
ttcagcaatgctaactcagttaaggaaaacacaagtgcaactaccaagaccaccacaaat
agaacaaaaacgggtgtgagtaaagtgcagaagggtaagacgagagcaagaacaacaaga
agttctacaattacaaaaccaccggacctggacgatataaccaagctagaaaatcagaaa
tccaatgaactcaataaagccaataatgcagttgccaatctgcagctccatatcgccgac
atgcagaagtcatcagcagaagggcttcttcgcttactacgagatgttggcaaagcctac
caggcgctaagccggtatgatctaaagaaagctgtggagctcttcaaatcccttccacct
caacactacaacacagcatgggtgctatgtcaggttggcaaggcgttgtttgagatggct
cagtatcacaaggcggaggcaatatttgcagaagtgcggagactagagccccaccaccta
ggttacatggagatctactccacgacattatggcacttacagaaggagactgcgctctcc
gcccttgcacaggatctcacagacttaaatccagaatctcctcaggcctggtgtgcagct
ggaaactgcttcagtttacagaaggaacatgactctgctatcaagtttttccaaagagca
atacaggtggatcccaagtttgcctatgcgtacacgttattgggtcacgagtacgtagct
acagaggaactagacagagccatggcctgcttcagaaatgctataaggataagccctaga
cattataatgcatggtacggtactggtatgatctactataagcaggagaagtttgccctt
gccgagatgcattactgtaaagcacttgccatcaacccccagagctctgtattactggtt
catatcagtgttgttcaacatgcacttcacaagtcggatcaagccctcgctaccctagcc
aaagccgtgcgccttgatgcaaacaaccctctctgtagatttcaccgtgcttcaatattg
tttgctaccgagaaataccaggatgccttgaaagaactagaagaaatgaaacagatgact
ccatcagaatcattagtctacttcctcataggcaaggtttacaagaaactaggccagact
catcaagccttggccaacttctcctgggccttagacctggatccaaagggagccaatagc
cagatcaaagaagctctagacaagcactatctaccagaggatgacgaacctgcagtccct
gcactagctcaagcagacacacccagtcaaggaggtattgaagactctgacgcagcaggg
gatatatcgagggaaagtttactcgatggagaggacatgcaactccaagcaaatgagagc
gacgagagtttatga

DBGET integrated database retrieval system