KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581757Help
Entry
581757            CDS       T01019                                 

Definition
uncharacterized LOC581757
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     581757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 575 aa AA seqDB search
MSVNYAEGLSPYDHKGKCGLPEKFDEPEVVAEKVKKLADLVKRSRHMVVHSGAGISTAAG
IPDFRGPKGVWTLEKQGKKPEANVTFDTAKPTATHMALVELERRGKLQYLISQNIDGLHL
RSGFPKDRLAELHGNMFVEQCHRCRRQTIRAMPVPTLGLKPTGNRCSDKPGRGTCRGKLH
DTILDWEDALPETDLTQAEEHLRKSDLSICLGTSLQIIPSGTLPKLTKKNGGSLVIVNLQ
PTKLDKQADMKINCYVDEVMTQLMEQLGYPIPEYTGPSLVLESQQGLSTKNIKDTMHVGD
SQKNCKVDSECVDDRRKVAVKDEVKEESMNDGQKVEIKDEVKEKVQKERVSEDLEVSPEM
KREAHLNSHETPDQKVEQSCIRLESIEDRQKVAVKDEVKESCLSDGQKVETKDEVKEKVQ
KERVSEDLEVPPEVKSEAHLDSHETPQENSEQSCKRLCPDTSEVIQDDVAKDTEKHEASD
NSFRTCKHEDDDMRETVDIQETSCLVGSDSKQTFENMCSVKQEIHVKSGSADTTDIKPGC
PDNWSDSKRTDDEESVENITSGAVKRDAEGNIKVC
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaattatgctgaaggtctttcaccgtacgaccacaaagggaaatgtggtctt
cctgagaaatttgatgagccagaggttgttgctgagaaggtgaagaaacttgcagattta
gtgaagaggagtcgtcacatggtggtgcacagtggggcgggcatcagcactgcagctggc
attccagattttaggggacctaaaggggtatggaccctggagaagcagggcaagaagcca
gaggcgaatgtgacctttgacacagccaagcccaccgctacccacatggcgttggttgag
ttggagaggagagggaagctgcagtatcttatcagtcagaacatcgatgggcttcactta
agatctggctttccaaaggacagactggctgaactgcatggaaacatgtttgtggagcag
tgccacagatgcagaaggcaaactataagagccatgccagttccaacattgggtctgaaa
ccaacagggaatcgatgcagtgacaagccaggaagaggaacatgcagaggaaagctgcat
gacacaatacttgactgggaagatgctttgcctgaaacagatcttacacaagccgaagaa
catttacggaagagtgacctgtcaatatgcctaggaacctctctacagatcatacccagt
gggactttacctaaactgaccaagaagaacggagggtcactggtcattgtcaatttacag
ccgaccaaactggataagcaagccgatatgaagatcaattgctacgtcgatgaggtcatg
acccagttgatggagcagcttggttacccgataccagagtacaccggaccctcgctggtc
ctcgagtcacagcagggactatccaccaagaacatcaaagacaccatgcacgtaggagac
tcacagaaaaactgcaaggttgatagtgaatgtgtagacgataggcggaaggtagcagtg
aaagatgaagtaaaggaggaatctatgaatgatggacagaaggtggaaataaaagatgaa
gtaaaggagaaggttcagaaggagagagtttcagaggacttagaagtttcccctgagatg
aaacgtgaagcacatcttaattctcatgaaactcctgatcagaaagtagagcaaagctgc
ataaggttagaatctatagaagatagacagaaggtagcagtgaaagatgaagtaaaggag
agttgtttgagtgatggacagaaggtggaaacaaaagatgaagtaaaggagaaggttcag
aaggagagagtttcagaggacttagaagttccccctgaggtgaaaagtgaagcacatcta
gattctcatgaaactccccaggaaaattcagagcaaagctgtaagaggttatgcccagat
accagtgaagtgattcaagatgatgttgcaaaggatacagagaagcatgaggcatctgac
aattctttcaggacatgcaagcatgaggatgatgacatgagggaaacagtagacattcaa
gagacatcatgcttagtggggtctgatagcaaacagacatttgaaaatatgtgttctgta
aaacaagagattcatgtgaaaagcggatcggctgatacaacagatattaaacctggttgt
cctgacaactggtcggattcaaagaggacagatgatgaagagagtgttgagaatattacc
tcaggagcagtgaagagggatgcagaaggaaacatcaaagtttgctga

DBGET integrated database retrieval system