KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581761Help
Entry
581761            CDS       T01019                                 

Definition
(RefSeq) early endosome antigen 1
  KO
K12478  
early endosome antigen 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    581761
   04145 Phagosome
    581761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1532 aa AA seqDB search
MDAIKRFGRKARDSVKTVTPESPSRSSGYEEQEASGFICPTCMVALSSPEQLQSHWESVH
NTDFGGGAAAMEPEVVASPAATTNAARQNSVQANDRVGDVEILRQEVNELKTSLKEEQWY
ATELKKEVDRLKSGEEPMLIDDTDLFKEQLKKSEENRSLLSSEVVLLRQDLGESKQTATN
YKTIKDAMEQKAASLAGDVATIRAELDEEKGHHLALKEALEQTQFELRDRDNQLKVMESQ
ALQRTADDDITVLKKELVSIQTLMDQMSLEAEAEKKELEKHCGELKTKNAESEAQIKALQ
AEIEIAPKKEEVLKLQSSISETSSSSQALQQQLKEATDTNNSLQLKLTEVQGNLRESEVL
KEKVQQELDFTRLNEIKALQTEIEIAPKKEEVLKLQSSISETSSSSQALQQQLKEATDTN
NSLQLKLTEVQGNLRESEVLKEKVQQELDFTRQQFQRDISSKDNQSSDLQIQMSKANERL
QELEVANQKLKQELEFSEQQHQHQLTSKGNQSVELQQQIEKLQASIKERDEEVEKVRKDL
SGSRLSGEDQIRHTEQKLTALKLEHSKVEEALKEQQGLVSSLQQQLDTAKQQYQQESNHS
DDLGSQLRDKEAQLEEHARNLSERDAKITDLESTIQKQKEANEKMEAEKTDLISQIQAGE
GVETAIQQLKQEVDDFQKEVSDLEASKETLAQEHHEKTEQLYKQLKEAKSHLESEKAKLE
RTETNLADTTGKLAGTQEKLVATEAEVKSKNELLHAAEASIATQRADLESHLRTSQTALE
DKQKDMDRVQELLQQTKDELTSSKDQVKGLETQVQEVKGELTNSQHQYSLLQTDLKNKDN
QISTIEASKDAQKAELEEKTTNIQAVVTERQKALDLITEQFQTTSKDLTSCESKLGQTEA
SLQSTQDQLASTASTLAKMEEEMQSTKDSLESKSRELTDLRSNSEKSIEESQAAISKLQK
EREELESTLNASNAEHQYQMTVVNERVNNLQESLDSRNTVLQDKEQLVKQQVEQHAQEKT
KFTEEMTNKLNSEQAKVTELTNALDTTQMQLVEAKAGLAEKTQSELVLTDRVSELEASRI
SLHAELTAEQQETAHLKKQTELQDGSLAESFSKCEMLEQQIVTRDNVQRDMQQKIEVLEK
DLAKECQLCKNYEVQVVKLESKIKELGDKSSALKTEVESLHASLTKTEEDLEVVRGSEAS
LMCSVKGLQEINSSLDGKMSTLERSLQDKERSFNEEKATLTSSLEQERTAASELRESRDG
FQSELEQTKGLLQTEKTERAKEVSSLQDARQLLITQKLELQSQLTEKDNGLSAALADHEE
TKEVSKKVQNMLREESAALQSKLASETQAKVEAEEERERQEQRYNMQLSALNENLGTLRS
DMMQADTRSRELEKTVEDFQGEKHVMEATIQNSQDERRALLERCLSNEKDVEKLQAKTAE
LRRKLDDAQAAMHELGRENQALQITQTKAMGRKWTDDKEVLDCMSCSKAFSLAVRKVRFL
ITYRHLIAVIKVLQVLYQGVVEVLYQGVVEVL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagcgatttggacggaaagctagggatagcgtgaagactgttacccct
gaaagtccgagtaggtcttctggctatgaagaacaagaagcatcggggttcatctgccca
acctgtatggtggcactctcctctccggagcagcttcaatcccactgggagtcagttcat
aacacagacttcggaggaggagcagcggccatggaaccggaggtagtagcatcaccggca
gcaaccaccaatgctgcacgtcagaattcagtccaagccaatgaccgagttggagatgta
gagattttacgtcaggaagtcaacgaattgaagacctccttgaaagaagagcaatggtat
gctactgaattgaagaaggaggtggacagattaaagtctggtgaagagccaatgttgata
gatgatacagatttgttcaaagaacaattgaaaaagtcagaggagaatagatcactatta
tcttcagaggttgtccttttaagacaagatttgggtgaatccaagcagacagcaactaat
tataagaccattaaagatgccatggagcaaaaagctgctagtttggcaggggatgtagcc
acaatccgtgcagagctagacgaagagaaagggcaccacttagctctcaaagaagccttg
gaacagactcagtttgagctgagggacagggacaatcaactcaaggtcatggagtcccaa
gcattacaaaggacagctgatgatgacatcacagttttaaagaaggagctggttagcatt
caaaccctgatggatcagatgagcctggaggcggaggcagagaagaaggagctggagaaa
cactgtggagagctcaagactaagaatgcagagtcagaagctcagatcaaggctttacag
gcagagatagagattgctcctaagaaagaagaagttctgaaattgcagtctagtatcagt
gagacctcatcaagtagtcaagctttacagcaacagctcaaagaagctacagacacgaac
aacagcttacaactcaaactcaccgaggttcagggaaatttaagagaaagcgaggttcta
aaggagaaagtgcaacaggagctagacttcactcgcctcaatgagatcaaggctttacag
acagagatagagattgctcctaagaaagaagaggttctgaaattgcagtctagtatcagt
gagacctcatcaagtagtcaagctttacagcaacagctcaaagaagccacagacacaaac
aacagcttacaactcaaactcaccgaggttcagggaaatttaagagaaagcgaggttcta
aaggagaaagtgcagcaggagctagatttcactcgccagcagttccaacgagacattagc
tcaaaggacaaccagagttctgatctacagatacagatgtcaaaggcaaacgaaaggctg
caggagttggaagttgccaatcaaaagttgaagcaagaacttgaattcagtgagcagcaa
caccaacatcagctcaccagcaagggcaatcaaagtgtggagttgcagcaacagattgaa
aagctgcaagcatccatcaaggagagagatgaggaggtggagaaggtgaggaaagattta
tctgggagtaggctgtctggtgaagatcaaatcagacacacggaacagaaactgactgct
ctcaagctagaacacagcaaggttgaggaggctctgaaggaacagcagggtctagtgagt
agtctacaacagcagcttgacacagccaaacagcagtatcaacaagagagtaaccatagc
gacgacctagggtcacagctcagagacaaggaagcgcagttggaggagcatgcaagaaat
ctctcagaaagagatgctaagataacagatctggagagtaccattcagaagcaaaaagag
gccaatgagaaaatggaagcagagaagacagatctgatatcacagattcaggctggagaa
ggggtagagactgccatccaacaactcaaacaagaagtggatgacttccagaaggaggta
tcagacctggaagcaagtaaagaaacgctggcacaggagcatcacgagaaaacagaacag
ctttacaaacagctcaaagaggccaagagtcaccttgaatctgagaaagccaaactggaa
aggacggaaacaaatctggcagatacaaccggcaagttggcaggcactcaggaaaaactt
gtagctacggaagctgaagtcaaatcaaagaatgagttgttacatgctgctgaagcctcc
attgcaacccagagggccgatctagagagtcatctacggacatcacagacagcacttgaa
gataagcagaaggacatggatagggtccaggaactactccaacagaccaaggatgaactg
acttcatccaaggaccaggtcaaaggtcttgagacacaggttcaagaggtcaaaggtgaa
ctaaccaacagccagcaccagtactcactactgcagacagacttgaagaacaaggacaac
cagatatcaaccattgaagcttctaaagatgctcagaaagcagagctggaggagaagact
actaacatacaagcagtggtgacagagagacagaaagctttagatcttatcacagaacaa
ttccaaacgacatctaaagatctgacatcgtgtgaatccaagctgggccagacagaagct
tctcttcaaagtactcaggatcaactagcctccactgccagtactttagctaaaatggaa
gaagaaatgcagtctaccaaagatagtctggagtcaaagtctagggagctgacagacctc
agatcaaatagtgaaaagtcaatcgaggaaagccaggccgctatctcaaaattgcagaag
gagagagaggaattagaatcaacgctcaatgcctccaatgcagagcatcagtatcagatg
accgtagttaacgaacgggtgaacaatctacaagagtctttggattctcgtaacactgta
ctacaagacaaggaacaactcgtcaaacaacaagtagaacaacatgcacaggaaaagacc
aagtttacagaggagatgacgaacaagctgaactcagagcaggctaaagtcacagagcta
accaatgctcttgatactactcaaatgcagcttgttgaagctaaggctggattagctgag
aagacgcaatcagagttggttctgacagaccgtgtgtcagagctagaggcaagccgcata
tctctgcatgctgaactcactgccgaacaacaggagaccgctcacttgaagaaacagacg
gagctccaagatggctcactggcagaaagcttttccaagtgtgagatgcttgaacaacag
atagtcaccagggacaatgtgcagagagatatgcagcagaagattgaggtattagagaag
gacttggctaaggaatgtcaactgtgtaagaactatgaagttcaagtggtcaaactggaa
tctaaaatcaaggagcttggtgacaagtcatcggctctcaagacagaggttgagagtctc
catgcatcactcacaaagacggaagaagatctagaggtagtcagaggcagtgaggcatct
cttatgtgcagcgttaaaggcttgcaagagattaattccagcttagatgggaagatgtct
acactagaacggtctctgcaagataaagagaggtcattcaatgaagaaaaggctacattg
acatccagtcttgagcaagagagaaccgcggcgagtgagttaagagaaagcagagatgga
ttccagtcagaactagaacaaacaaaaggcttactacagacagaaaaaacagaacgagca
aaggaggtaagctccctgcaggacgccagacagctgctaattactcagaagctagaactg
cagtctcagctgactgagaaagacaacgggctgtctgctgccctcgccgaccacgaagag
accaaggaggtgtcgaagaaggttcagaatatgctgcgggaggagagtgctgcattacaa
agcaaactggctagtgagacacaagctaaggtggaagcagaagaggagcgagagcgtcag
gagcaacgctacaacatgcagcttagtgccctcaacgagaacctgggcacgctacgtagt
gacatgatgcaggctgatacgcgctccagggaactggagaagaccgtagaagactttcaa
ggagaaaaacatgtcatggaggcaaccattcaaaacagtcaagatgagaggagagccctg
ctggaaaggtgcttgagcaatgagaaggatgtggagaagctgcaagcaaagaccgccgag
ctgcgacggaagctggacgatgcgcaggcggccatgcacgagcttggtcgtgagaaccaa
gcccttcaaatcacccagaccaaggcaatgggtaggaagtggaccgatgataaggaggtg
ctggactgcatgtcctgtagcaaagctttctcacttgctgttaggaaggtacgtttcttg
ataacctatagacatttaatcgcagttatcaaggtgttacaggtgttgtatcaaggtgtt
gtagaggtgttgtatcaaggtgttgtagaggtgttgtag

DBGET integrated database retrieval system