KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581896Help
Entry
581896            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     581896
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   581896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 516 aa AA seqDB search
MPSYKINVKWGKEKFSDITCNTEETPEVLKAQMFALSGVYPQRQKIMLKGQVLKDDEWGN
FKLKEGVTLLMMGSAETLPEAPQEKTVFVEDMTEEELATAMELPCGLTNLGNTCYLNATL
QCLRSVPDLREQLRSYQGNMNMAIAASAPAESMTVAIKDLYTVMDKKSEAFPPIILLQLL
HLAFPHFAEKSEHGGFQQQDANECWIQLVRLLQQKLPAVKPSDSIPAVEGAPAAAGAVAK
RTFVDQYFGCEFESMLKCIESEEEPPVKSKETFYQLSCFITQEVKYLHTGLKNRLQESLV
KSSPTLNRDAQYLKESKISRLPGYLIVQFVRFYYKEKEAISAKILKDIKYPMTLDTYELC
SPELQEKLVPVRDKFKEMEDRNLELAQKAKDAAKGGNKSAAVTTEPKKDVKYLPYDFPDD
IGCNNSGYYELQAVLTHQGRSSSSGHYVAWVKKIRDEWIKFDDDKVTPVHSEDILKLSGG
GDWHCAYVVVYGPKRLEEMPPETKKAEEKSEDVPME
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccatcatataagatcaatgttaagtgggggaaggagaagttcagtgacataacatgc
aacacggaggagacccccgaggttctgaaggctcagatgtttgccctgtcaggcgtgtac
cctcagaggcagaagatcatgctcaaggggcaggtgctcaaggatgacgagtggggaaac
ttcaagctcaaagagggtgtcactctcttgatgatggggtcagcggaaaccttgccagaa
gctcctcaagaaaagactgtctttgtggaagatatgacagaagaggaacttgccacagct
atggagctgccttgtggtctaaccaacctcggtaatacatgctacctgaatgctactcta
cagtgcctccgaagtgtaccggaccttcgagaacagctcagatcgtatcaaggtaacatg
aacatggccatagctgccagtgcccctgctgaatccatgaccgtggccatcaaggatctt
tacaccgtcatggacaagaagtctgaagctttccctcccatcatcctcctccagctcctc
catcttgcattcccacactttgcggagaaaagtgaacatggcggattccaacagcaggat
gccaacgagtgctggatacaacttgtacgacttctgcagcagaaattgcccgctgtgaaa
ccgagtgacagtatacctgctgttgaaggagcgcccgctgctgcaggagctgtggccaag
agaacatttgtagatcagtacttcggctgcgagtttgaaagcatgttaaagtgcatagag
tcggaagaagaacctcctgtgaagtccaaagagacattctatcagctcagctgctttatc
acacaagaagtcaagtatcttcatacaggactcaaaaacagattgcaagagtctttagtg
aagagctctcccacactcaacagagatgcacaatatctcaaagagtctaaaatcagcaga
ctaccgggctatctaatagttcagtttgtccgattctactacaaagagaaagaagccatc
agtgctaagatcttaaaggatattaaatacccgatgaccctagatacgtatgaactttgt
tcacctgagctccaagaaaagctggtccctgtcagggataagttcaaagaaatggaggat
aggaacctggagcttgcacaaaaggcaaaggatgcagccaagggcggaaacaagagtgca
gcagtaaccacagaacccaaaaaggatgtcaagtaccttccatatgacttcccagatgat
attgggtgtaataacagtggctactatgagctccaggctgtgctgacccatcaaggaagg
tcaagctcatcaggtcactacgtagcatgggtcaagaaaataagagatgaatggatcaaa
tttgacgacgacaaggtgaccccagtccacagtgaggacatcctgaagctgtcaggggga
ggggactggcactgcgcctacgtcgtcgtctatggccccaagaggctggaggagatgcct
ccggaaacaaaaaaagcagaagaaaagtcagaagatgtcccaatggaataa

DBGET integrated database retrieval system