KEGG   Strongylocentrotus purpuratus (purple sea urchin): 582289Help
Entry
582289            CDS       T01019                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    582289
  Replication and repair
   03420 Nucleotide excision repair
    582289
Transcription machinery [BR:spu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     582289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 328 aa AA seqDB search
MYHTSSQLREWTFQSQEELNEKRAASNRRYREEHQAKSEGKDPATFFLSEAEERTLCESY
EFLLRAFCKKFQPPVPPAVVGTSCAYFKRFYIYNTAMDYHPKYIMLTCVYLACKVEEFNV
SISQFCGNLQPEEQEKMAELILSHELLVMQQLNYQLTIHNPYRPMEGLFIDIKTRFPAMK
QPELLRKGAEEFINRSLATNACLLCSPSQIALAALVSSSARQDTNIDKYVTDYLMRGRDN
PKDLPDIVNTIKHIRQLVRKMPQLNPEAAKQLERKLEKCRNDELNPESHVYKKRLQDQLN
ADDEEIYVKHQLDAEETRRKEKELLMSV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtatcataccagcagtcagttgagggaatggacatttcaatcccaagaagaattgaat
gagaaacgggcagcttccaaccgaagatacagggaggagcatcaagccaaatctgagggt
aaagatccagccactttcttcctcagcgaagcagaggagaggacactttgtgaatcatac
gagtttcttctcagagctttctgtaagaagtttcagccccctgtgcctcctgctgttgtg
ggaacatcatgtgcctacttcaagaggttctacatttacaacacggcaatggactaccat
cccaaatacatcatgttgacgtgtgtgtacctggcgtgcaaggtggaggagttcaatgtc
tccatctcacagttctgtggcaaccttcaacccgaggaacaggagaagatggcggagttg
atcctgagtcacgagctgctagtcatgcagcagcttaactatcagctgactattcacaat
ccatacagacccatggagggcctcttcattgacataaagacaaggtttccagcaatgaag
caaccagagctgctgaggaaaggagctgaagagtttatcaatagatctctagctaccaat
gcatgtttactttgttctccatcgcagattgctcttgcagcccttgtatcgagttctgca
agacaagacacaaacattgataagtatgtgactgattatctgatgaggggtagagataat
cccaaggatctgccagatatagtcaacacaatcaaacatataagacagttagtaagaaaa
atgcctcagctcaacccagaggctgccaaacaactggagaggaagcttgagaagtgtcgc
aatgatgaacttaacccagagagccatgtatacaagaagaggttacaggaccaactgaat
gcagacgatgaagaaatctatgtaaaacatcaactagatgcagaggaaacaaggagaaaa
gaaaaggaactgctgatgagtgtatga

DBGET integrated database retrieval system