KEGG   Strongylocentrotus purpuratus (purple sea urchin): 582506Help
Entry
582506            CDS       T01019                                 

Definition
uncharacterized LOC582506
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     582506
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   582506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 635 aa AA seqDB search
MTILPKKKVQQEKRGAESGENHQHHGHNSHHHLAHNLGHSVSHSTGESRGGARPKSRNSP
PRWNANNQRDDRLSNHDARTSYDSQERRENSHGGHSSNKRARHRSSPQHEYSDFEYDHAG
AVSWTPNNSTNSQAEIRGSSPRESEQDEEVDAVNSGDEHEENTEETENIEEIEERFARAL
KEKKGFIIKIMVPDGACLFRSVADQVYGDQDWHNIVRGHCMDYMTKNADYFSQFITEDFP
TYIARKRLDSCHGNHVEMQALSEMYNRNIEVYMYSTEPINTFHTLNKTDNDPIRVSYHRN
VHYNSVVNPHKATVGVGLGMPSFVPGLADKTLMREAIHISEKSAIEQTMLQDKLLATDWE
ATNEAIEEQVARESFVQWLKDNEKRAEKKALPATATCSSAPPDSPPGWWGEANQKSGASQ
GGHHSGKKHPSGKHNSGKHSSSHHALSGHHPSSGHHSGGHLVTPHHQSSHLVSPHHPSGH
VVGPHHPSGRLSPRNRGTGSGSRPNSPERLEAARLRPLSPNSIRGRNAEKKAQQQQQQQQ
QLLSKADRPTTSGHISNPASPQGAHARDTASPKAGPSGYNPPTASHGMEDIPPEEFGISE
WESEDAILASILAQSHQEYLDTLIRSTHKDTDSDS
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgactattttaccaaagaagaaggttcaacaggagaaaaggggcgcagaaagtggtgaa
aatcatcaacatcatggacacaatagtcatcaccatcttgcacataatttaggtcactct
gtatcgcattctacaggagaatcaaggggaggagcacggccaaaatctcgtaattctccg
cctcgttggaatgcaaataaccaaagagatgatagactgagtaaccatgatgcaaggact
agttatgattctcaagaaagaagagaaaattcacatggaggacattctagtaataaaagg
gcgaggcaccggtcgtcccctcaacacgaatatagcgattttgagtatgatcacgcagga
gctgtgtcatggactccaaacaattcgacgaactcacaggccgaaattagaggctcaagc
cctagggaaagcgaacaagatgaagaagtcgatgctgtaaatagtggcgatgagcatgaa
gaaaatacagaagaaacagagaatatagaagagattgaagaacggtttgcccgagctttg
aaagagaagaaaggtttcatcatcaagatcatggttcctgatggagcatgtttattcaga
tcagttgctgaccaggtttatggagaccaagattggcataatattgttagaggacactgt
atggactacatgacaaagaatgcagattacttctcacaatttatcactgaggattttccg
acgtatattgcccggaagcgtctagacagttgccatggtaaccatgtagagatgcaagcc
ttgtcagagatgtacaatcgtaacatcgaggtttatatgtacagtacagaacctatcaac
acatttcacaccctgaacaagacagacaatgatcctatacgtgtgagctaccaccgcaac
gttcactacaactcagtcgtcaatccacacaaagctacagtaggagtgggtttaggaatg
ccctcatttgtaccagggcttgcggacaagacgttgatgcgagaagctatccatatatca
gagaagtctgccatcgaacagaccatgttgcaggataaattgctcgccacagactgggag
gcaaccaacgaagcgattgaggaacaagtagcgagggaatcctttgttcagtggctcaag
gacaacgagaaaagagcagagaagaaagcactccctgctacagctacctgtagttctgca
ccaccagactctcccccaggatggtggggtgaggccaaccaaaagtctggtgccagccaa
ggcggccaccactctggcaagaagcaccctagcggaaagcacaacagcggaaaacactcc
agctcccatcacgcgctgagcggccatcacccttcctctggacatcactctggtggtcat
ttggtcactccacaccatcaaagcagtcatctggtctccccacaccaccccagtggacac
gtggtaggtcctcaccatcccagtggacgtctgtcgccaaggaacaggggcactggcagt
gggtccagaccaaatagccctgagagactcgaggcagcaaggctgagacctttatcgcct
aattcaatccggggaaggaatgcagagaagaaagcgcaacaacagcagcagcagcagcag
cagcttttgtcaaaagcagatcgtcccacaacaagtggccacatctctaatccagcttct
ccccaaggcgcccatgccagggacacggctagtcccaaggcagggcccagtggctacaac
ccacctacggcctcccatggaatggaggatataccaccagaagaattcggtatatctgaa
tgggagtctgaggatgctatcctagcctcaattcttgcccaatcccaccaggagtaccta
gacaccctcatacgtagcactcacaaggacaccgattcagacagttga

DBGET integrated database retrieval system