KEGG   Strongylocentrotus purpuratus (purple sea urchin): 582727Help
Entry
582727            CDS       T01019                                 

Definition
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial-like
Orthology
K11351  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    582727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 169 aa AA seqDB search
MASLSRVWRIGSKVLTGSSSLVRPNLRSIPCRVYSSTTKKVEQSEFVIGKQTEIDPARVE
EIIKEGTRLESDSDASDPTYVTHGFHDDPYWDTYAYRVIFFTTISIVMVFGPAFVHYLPD
PTGREWARKEALVVLDERRAAGALVIDPNFIDPSKLVLPEEDPEPLRTA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctctaagcagagtgtggagaattggaagtaaagttttaacgggaagttcatcc
cttgtccgtccaaatttgaggtcaattccttgccgagtttacagttctactacgaaaaaa
gttgaacagtcagaatttgtaatcggaaaacagacagaaatcgaccctgcgagggtagaa
gagatcatcaaagaaggcacccgtctcgaatcggactccgatgcatcagatcccacatac
gtaacacatggatttcatgatgacccctactgggacacgtatgcgtacagagtgatcttt
tttacaaccatctccatcgtcatggtatttggtcctgcttttgtgcactacttacccgat
ccgactggaagggaatgggcgagaaaagaagcactggttgtcttggacgagaggagagca
gcaggagcactggtcatcgaccccaacttcattgaccccagcaaactggttctacccgag
gaggacccagagcctctccgtacagcatag

DBGET integrated database retrieval system