KEGG   Strongylocentrotus purpuratus (purple sea urchin): 582864Help
Entry
582864            CDS       T01019                                 

Definition
cytochrome c, somatic-like
Orthology
K08738  
cytochrome c
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    582864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 116 aa AA seqDB search
MAANDDVIPPVDPEKGAEIFREHCAGCHDIDKSGEHRAGPNLMGVWGREANTIEGFAFVE
SDEKKGVIWGDKTIYDFLEKPHIPGTKFIFRELRGKAEEKANLVAYLKKTTDPKNS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaatgatgacgtcattcctccggtcgatcccgagaaaggagccgagatcttc
cgagagcactgcgccggttgccatgacattgacaagagcggggagcacagggcggggcct
aacttgatgggggtatggggaagagaggcgaatacgatagagggtttcgcctttgtggaa
tctgacgagaagaaaggggtcatttggggagacaagaccatttacgattttctggagaag
cctcacattcctggaacaaagttcattttccgcgaactcagagggaaagcagaggagaag
gccaaccttgtcgcttatctcaagaaaacgacggaccccaagaattcatga

DBGET integrated database retrieval system