KEGG   Strongylocentrotus purpuratus (purple sea urchin): 583067Help
Entry
583067            CDS       T01019                                 

Gene name
eef2k
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 683 aa AA seqDB search
MAELQFEITDLDHDHQVNGNYNGNHNHSSDEDEEMLIEPLIDFLLKEPTTHSTPIKNENI
NKTKKRSPTCAKLKWKWAFQQVRKMNDPWKEFHLEDLPIDTAIRHRYNAVEKTWVQDEVQ
VKMGSESFAHGAMRECFRMKKKSNFSKHHQWKNSGNFVAKRYMETVERDVYFQDVRLQMD
AKIWGEEFNRHNPPKKVDIFQMAVLEFMNRPGKPLFHLESYIEGKYIKYNSNSGFVRDEA
LRKTPQAFSHFTFERSGHKLIVVDIQGVGDLYTDPQIHTSTGTEYNEGNLGMRGMALFFA
THACNEICDHLELTQFDLHCSEFTEHEKYVKLQKNSGTICRGTENRVFKPRARPSISPLD
MTQFVVFERSNSQMSTGSSVVLSPLAESPPRRISFQELPSSPDDVAMSMSPPPSVLNQFQ
RRTARFRLDSESESETLSHDDEKRAKFLERNVNHRPSCVNLEVQLRKTMLVTSTGGSILG
QIHLDMAKYHEMGRFAPDDNSRNMEAALYHLRHGADCGVLEAIIAMARICLQLTHDVLTE
VSVPSDDEDYMNEGMDYMETAAEAGDRAAILFVARAYDTGHNLGTARTKSWLEAMHWYEE
AVNTEKVDEDGHYDSTMDDPNYLLSARMAEMYRAGGPDLDKNPEKAAELYNEAAEGAIAA
MKGRLSNKYYMLAEECYGEMEEE
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctccaatttgagatcaccgacctcgaccacgaccaccaggtcaacggtaac
tacaatggaaatcataatcacagtagcgacgaggacgaggagatgctcatcgagcccctg
atcgacttcttgctcaaggagccgacgacacacagtaccccgattaagaatgagaatatc
aacaagaccaagaagagaagccccacatgcgccaagctgaagtggaagtgggccttccag
caggtgaggaagatgaacgacccctggaaggagttccacctggaggatctccccatagac
acggccatcagacatcgctacaacgccgtcgagaagacctgggtccaggatgaagtccag
gtcaagatgggttcagagtcttttgcacatggagccatgagagagtgttttagaatgaag
aagaagtctaacttcagcaagcatcaccagtggaagaactctggtaactttgtcgctaag
cgttacatggagacggtggaaagagacgtctattttcaagatgtccgtcttcagatggac
gccaagatctggggagaggagttcaaccgccacaatcctccaaagaaggtggatatcttt
cagatggctgtcctggagttcatgaatcgacctggtaagcctctcttccatttggagagc
tacatagagggcaaatacatcaagtacaactcaaactctggatttgtcagggacgaagca
ctccgaaaaacaccacaggcattcagccacttcacatttgagaggtccggtcacaagctc
atcgttgtagacatccaaggtgttggcgatctgtacaccgatcctcaaatccacacctct
accggtacggagtacaacgagggtaacctcggcatgcgcgggatggcgctcttcttcgcc
acccatgcctgcaacgagatctgtgaccatctggagctgacccagtttgacctccactgc
tctgagttcacggaacatgagaaatacgtgaaactgcagaaaaattctgggaccatctgc
cgaggtaccgagaaccgcgtcttcaaacctcgcgcaaggccctccatctcccctctcgac
atgacccagttcgtcgttttcgagcggtccaactcgcagatgtcgacgggctccagcgtg
gtcctgtctccgcttgccgaatcgcctccgaggcgcatttccttccaggagctcccttca
tcacctgacgatgtcgccatgtcgatgtctccacctccaagcgtgctcaatcagttccaa
agaaggacggcacgttttaggttggactcggagagcgagagcgaaacgctgtctcacgat
gatgaaaaaagggcaaaatttctggaaagaaatgtgaaccacagaccatcctgtgtgaac
ctggaggttcagctgcgaaagactatgctggtgaccagtactggaggctctatcttagga
cagattcatctggacatggctaagtaccacgagatgggccgcttcgctcccgatgacaac
agccgtaacatggaggctgccctctaccatctgcgtcacggtgcggactgcggagtcctg
gaagctatcattgccatggctaggatctgcctacagctaacccacgatgttctcaccgag
gtgtctgtaccgagtgatgatgaagattatatgaacgagggaatggactacatggagacg
gctgcagaggcaggggacagggcagccatactgtttgtagccagagcatacgacaccggt
cacaacctgggaactgctaggacgaaatcgtggttggaggccatgcactggtacgaggaa
gcggtcaacacagagaaggttgatgaagacggccattatgattccaccatggatgatcct
aactacctgcttagtgctaggatggcagagatgtatcgggcaggcggaccggacctcgac
aagaaccctgagaaagcagctgagctttacaacgaagctgcagagggcgcaattgccgcc
atgaaaggccgcctctccaacaagtactacatgctcgctgaggagtgttatggtgagatg
gaggaggagtga

DBGET integrated database retrieval system