KEGG   Strongylocentrotus purpuratus (purple sea urchin): 583737Help
Entry
583737            CDS       T01019                                 

Definition
GTP cyclohydrolase 1-like
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    583737
Enzymes [BR:spu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     583737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 273 aa AA seqDB search
MSADHTDSVPNGDCPHLPNGLPSPARTDDADILAAKTHSLSLQDSSFHSTGRENLTMNGE
VPTKEEENRKLLKKTADSHASLYRQDSDKQLPGLALAYRSIIRGVGEDPNRQGLKKTPDR
AAKAMMFFTKGYEEKIEDVLNDAIFDEDHDEMVVVKDIEMFSLCEHHLVPFIGKVSVGYL
PNKRVLGLSKVARLVEIYSRRLQVQERLTKQIALAVTEAIAPAGVGVVIEAVHMCMVMRG
VQKLNSKTITSCMLGDFREDPKTRDEFLQLIRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgaccacacagattccgttccgaacggtgactgcccccacctcccgaacggt
cttccgtcgcctgctaggactgacgacgccgatatcttagccgcaaaaacccacagttta
tccctccaagacagcagtttccactctacagggagagaaaatctcacgatgaacggagaa
gtgccgaccaaagaagaagaaaatcgaaaactcttaaagaaaacagcggattcccacgct
agtttgtacaggcaagattcagataagcagctgcccggtctagcccttgcctaccggtcg
atcatccgtggcgtcggggaggatccgaaccgtcaggggctgaaaaagacgcccgatcgt
gccgccaaagccatgatgttcttcacgaaggggtatgaggaaaagattgaagatgtgcta
aatgatgcaatattcgacgaagatcatgacgagatggtcgtagtcaaagatatcgagatg
ttttctctgtgtgaacaccaccttgtgccattcataggaaaagtatctgttggttatctt
ccaaataagcgagtactaggtctcagcaaagttgcaagactggttgaaatatacagcagg
agattacaagttcaagaaagattgaccaaacaaatagccctcgctgtgacagaagctata
gctccggctggcgttggagtagtcattgaagccgtccacatgtgcatggtgatgcgtggt
gtccagaagctgaacagcaagacgatcacgtcctgcatgctcggcgacttccgagaagat
cccaagacgagagacgagttcctgcagctcatacgaggatga

DBGET integrated database retrieval system