KEGG   Strongylocentrotus purpuratus (purple sea urchin): 583779Help
Entry
583779            CDS       T01019                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:spu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    583779
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     583779
Peptidases [BR:spu01002]
 Metallo Peptidases
  Family M67
   583779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 487 aa AA seqDB search
MVMQQDPSIEPGQRVRSLAEHGSNIVVDGNLPIRRYFRSGQEMIKMANIYYEEGNWESAF
ILYSKYMTIFVEKIRKHPQYKAARPEDLKSAKKNLKSAFPNAEETKKKLREKYAEEHKIW
QVQEDERRAEEARQEAMEALRLEEEHARREQEDTARFDEQRRQLEELERHSIDQQQRELD
GQKASLMQAKAKQEALDQERKKADALNEQEWQAEGNRRLAGSIATPIAAGGAAGLVAGMG
AGMGAGGNLPPPPSYDAVSQGYGIRSPQVLPSSPTQPTAPRPAPTVDRSLKIDRTNKPAQ
MLGIASSTSNLHGLRDLFIPADTMERFLVLASHNTQRNLETCGILAGKLAHDAFTITHII
VPKQTSTSDSCTALNEEEIFDAVDNNDLITLGWIHTHPSQTAFMSSIDLHTHCPYQIMMP
EAIAIVCAPKHQQICFFSLTPDYGITFIANCKEKGFHPHPSQPPIYEEGGHCKVTSQIPP
IKIEDLR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgcagcaagatccgagtattgagccaggtcagcgggtccgcagtctggcagag
catgggtctaatatcgtggtggatgggaaccttccgatcagaaggtactttagatcaggc
caggagatgattaagatggcaaacatttactacgaagaggggaactgggagagtgcattc
attttgtattccaaatatatgacaatctttgtagagaagatacgaaagcatcctcagtac
aaggcagccagaccagaagatctaaaatctgcaaagaagaatttaaagtcggcctttccg
aatgcagaggaaacaaagaagaaattaagagagaagtatgcagaggaacacaagatatgg
caagttcaggaggatgaaaggagagcagaggaggcgcgacaagaggcaatggaagccctg
agactggaggaggaacatgctaggagggagcaggaggatactgcaaggtttgatgaacag
aggaggcagctggaggagctcgagagacattcaatcgatcaacaacagagggagctagat
ggtcagaaggctagcctcatgcaggccaaggcaaagcaggaagctctagatcaagagagg
aagaaagcagatgcattgaatgaacaagaatggcaagcagaaggaaacaggagattagca
gggagcatagctacacccattgcagctggtggtgcagcaggcttggtcgcagggatgggg
gcagggatgggggcaggggggaatctaccccctcctcctagttacgacgctgtctcacaa
ggatatggtatccgatcacctcaagtcttgccttcctcacccacacagcctacagcccca
aggccagcccccacagtggaccggtcactcaagattgaccgtaccaataaaccagctcag
atgttaggcattgcctcctccacatccaacctgcatggcttgagagacctgttcattcca
gctgataccatggagaggtttctagttctggccagtcataatacccagagaaacctagaa
acatgcggtattctagcagggaaattggctcacgatgccttcacaatcactcacatcatc
gttccaaagcagacgtcgacctctgactcctgtactgccctcaacgaggaagaaatcttt
gacgccgtggacaacaatgatctgatcactctgggttggattcatacacatccctctcag
acggctttcatgtccagtatagatcttcatacccattgcccgtatcagattatgatgcct
gaagccatagctatcgtctgtgcacccaaacatcagcaaatttgtttcttttccctgaca
cctgactacggtatcacctttattgccaactgcaaggagaaggggttccatccgcacccc
tcacaaccccctatctatgaggaagggggccactgcaaggtcacgagtcaaatcccacca
ataaagatagaagatctacggtga

DBGET integrated database retrieval system