KEGG   Strongylocentrotus purpuratus (purple sea urchin): 583779Help
Entry
583779            CDS       T01019                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:spu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 487 aa AA seqDB search
MVMQQDPSIEPGQRVRSLAEHGSNIVVDGNLPIRRYFRSGQEMIKMANIYYEEGNWESAF
ILYSKYMTIFVEKIRKHPQYKAARPEDLKSAKKNLKSAFPNAEETKKKLREKYAEEHKIW
QVQEDERRAEEARQEAMEALRLEEEHARREQEDTARFDEQRRQLEELERHSIDQQQRELD
GQKASLMQAKAKQEALDQERKKADALNEQEWQAEGNRRLAGSIATPIAAGGAAGLVAGMG
AGMGAGGNLPPPPSYDAVSQGYGIRSPQVLPSSPTQPTAPRPAPTVDRSLKIDRTNKPAQ
MLGIASSTSNLHGLRDLFIPADTMERFLVLASHNTQRNLETCGILAGKLAHDAFTITHII
VPKQTSTSDSCTALNEEEIFDAVDNNDLITLGWIHTHPSQTAFMSSIDLHTHCPYQIMMP
EAIAIVCAPKHQQICFFSLTPDYGITFIANCKEKGFHPHPSQPPIYEEGGHCKVTSQIPP
IKIEDLR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgcagcaagatccgagtattgagccaggtcagcgggtccgcagtctggcagag
catgggtctaatatcgtggtggatgggaaccttccgatcagaaggtactttagatcaggc
caggagatgattaagatggcaaacatttactacgaagaggggaactgggagagtgcattc
attttgtattccaaatatatgacaatctttgtagagaagatacgaaagcatcctcagtac
aaggcagccagaccagaagatctaaaatctgcaaagaagaatttaaagtcggcctttccg
aatgcagaggaaacaaagaagaaattaagagagaagtatgcagaggaacacaagatatgg
caagttcaggaggatgaaaggagagcagaggaggcgcgacaagaggcaatggaagccctg
agactggaggaggaacatgctaggagggagcaggaggatactgcaaggtttgatgaacag
aggaggcagctggaggagctcgagagacattcaatcgatcaacaacagagggagctagat
ggtcagaaggctagcctcatgcaggccaaggcaaagcaggaagctctagatcaagagagg
aagaaagcagatgcattgaatgaacaagaatggcaagcagaaggaaacaggagattagca
gggagcatagctacacccattgcagctggtggtgcagcaggcttggtcgcagggatgggg
gcagggatgggggcaggggggaatctaccccctcctcctagttacgacgctgtctcacaa
ggatatggtatccgatcacctcaagtcttgccttcctcacccacacagcctacagcccca
aggccagcccccacagtggaccggtcactcaagattgaccgtaccaataaaccagctcag
atgttaggcattgcctcctccacatccaacctgcatggcttgagagacctgttcattcca
gctgataccatggagaggtttctagttctggccagtcataatacccagagaaacctagaa
acatgcggtattctagcagggaaattggctcacgatgccttcacaatcactcacatcatc
gttccaaagcagacgtcgacctctgactcctgtactgccctcaacgaggaagaaatcttt
gacgccgtggacaacaatgatctgatcactctgggttggattcatacacatccctctcag
acggctttcatgtccagtatagatcttcatacccattgcccgtatcagattatgatgcct
gaagccatagctatcgtctgtgcacccaaacatcagcaaatttgtttcttttccctgaca
cctgactacggtatcacctttattgccaactgcaaggagaaggggttccatccgcacccc
tcacaaccccctatctatgaggaagggggccactgcaaggtcacgagtcaaatcccacca
ataaagatagaagatctacggtga

DBGET integrated database retrieval system