KEGG   Strongylocentrotus purpuratus (purple sea urchin): 583938Help
Entry
583938            CDS       T01019                                 

Definition
cAMP-dependent protein kinase catalytic subunit PRKX-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    583938
   04340 Hedgehog signaling pathway
    583938
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     583938
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   583938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 355 aa AA seqDB search
MASSRIKGKTSKRNGTSGKMKDLPPPSSAASNNNDHRKFDLSELELLKTVGTGTFGRVLL
TRDKKTKDYMALKVLTIEDIIKLKQEDHVRDEKAILSIINHPFIIKLHWTHHTDTFLYML
LEYACGGELFTYLRNSGRFNNDTGKFYAMEIISAIDYLHKETIVYRDLKPENILLDSEGH
VKLTDFGFAKKLVDNRTWTLCGTPEYLAPEIIQSKGHGKAVDWWALGILIYEMLAGYPPF
YDENPFGIYEKILACKIDWPQSIGSKPKKLIEGLLVIDRTKRLGCMRAGSNDIKNSDWFE
SIDWENVRQRQLKPPIVPKLSHAGDTSNFDEYPEENWETDASPVKSDVLKLFKDF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgagccgtatcaaagggaagacgtcgaaaaggaacggtacgagtgggaaaatg
aaagatttaccacccccatcctcggctgcctcgaacaacaatgaccacaggaagtttgac
ctgtcggaactggagttgctcaaaactgtcggtacgggaacttttgggcgagtgctccta
acccgggataagaagacgaaggattacatggccttaaaggtgctaacgatagaggatata
attaaactcaaacaagaggatcatgtgagggacgagaaggctatactcagcatcatcaat
catccattcattatcaaactacattggacgcatcacaccgacacgttcctctacatgctc
ctcgaatatgcctgtgggggcgaactctttacatacctccggaacagcggccgcttcaac
aacgacacgggcaaattctacgccatggaaatcatatctgcaatagactatttacacaaa
gaaaccattgtatacagagacttaaaaccggagaatatattattggattcagaaggtcac
gtgaagctcaccgattttgggtttgccaagaagcttgttgataacaggacgtggacatta
tgtgggacgccggaatacttagcaccagagatcatccaaagtaaagggcacgggaaggcg
gtagattggtgggcgttgggtatcctcatctatgagatgcttgcagggtacccacctttc
tacgatgagaatccatttggcatctacgagaagatcttagcctgtaagattgactggcct
cagtcaataggatctaaaccaaagaaactaatcgagggtctactggtaatagacaggacc
aagaggttaggctgcatgagggcaggctccaacgacatcaagaactcggattggtttgaa
tccatcgactgggaaaatgtcagacaaagacaactcaagcctccaattgttcccaaacta
tcccatgccggcgacacgagtaactttgatgagtacccagaagaaaactgggagacggat
gcatctcccgtcaagtcggatgtcctcaagctcttcaaagacttttga

DBGET integrated database retrieval system