KEGG   Strongylocentrotus purpuratus (purple sea urchin): 584273Help
Entry
584273            CDS       T01019                                 

Definition
ribonuclease P protein subunit p20-like
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:spu03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:spu03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 151 aa AA seqDB search
MASGDAQQAPQKDAARPHKSPKPKINPSTANIRKRQPRRLPKRKNDIYVTRKSNFASQME
QCEKLFDGGEKEVCIHSLGAAINRALNIALQLESRSLGTLQVAISTSTVDLVDDIEPLCD
EGDFDTRERSNSAVHIRVFRTESKKEEVPNK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggtgatgctcagcaggctcctcaaaaggatgcagcccgccctcacaagtcg
cccaagccgaagatcaacccctccacggcgaacatccgcaagcgtcagccccgcaggctg
cccaagcgcaagaacgacatctacgtgacgcgcaagtccaacttcgccagccagatggag
cagtgtgagaaactctttgatgggggagagaaagaggtgtgtatccacagtcttggtgcg
gccatcaacagagccttgaacattgctttgcagctggagtcccgaagccttgggacgctc
caggtggccatcagcacttccaccgtcgatctagtggatgacattgaaccgctgtgcgat
gaaggggactttgatacgagggagagaagcaactctgctgttcatatcagagtgtttagg
actgagagcaagaaagaggaggtgccaaataagtga

DBGET integrated database retrieval system